Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R4B5

Protein Details
Accession C4R4B5    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSTPARRRLMRDFKRIQQDAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000608  UBQ-conjugat_E2  
IPR023313  UBQ-conjugating_AS  
IPR016135  UBQ-conjugating_enzyme/RWD  
Gene Ontology GO:1990302  C:Bre1-Rad6 ubiquitin ligase complex  
GO:0000781  C:chromosome, telomeric region  
GO:0005737  C:cytoplasm  
GO:0033503  C:HULC complex  
GO:1990304  C:MUB1-RAD6-UBR2 ubiquitin ligase complex  
GO:0005634  C:nucleus  
GO:0097505  C:Rad6-Rad18 complex  
GO:1990305  C:RAD6-UBR2 ubiquitin ligase complex  
GO:1990303  C:UBR1-RAD6 ubiquitin ligase complex  
GO:0005524  F:ATP binding  
GO:0070628  F:proteasome binding  
GO:0003697  F:single-stranded DNA binding  
GO:0017116  F:single-stranded DNA helicase activity  
GO:0061631  F:ubiquitin conjugating enzyme activity  
GO:0071629  P:cytoplasm protein quality control by the ubiquitin-proteasome system  
GO:0006353  P:DNA-templated transcription termination  
GO:0000724  P:double-strand break repair via homologous recombination  
GO:0042275  P:error-free postreplication DNA repair  
GO:0070987  P:error-free translesion synthesis  
GO:0042276  P:error-prone translesion synthesis  
GO:0010390  P:histone monoubiquitination  
GO:0042138  P:meiotic DNA double-strand break formation  
GO:0031571  P:mitotic G1 DNA damage checkpoint signaling  
GO:2000639  P:negative regulation of SREBP signaling pathway  
GO:0000209  P:protein polyubiquitination  
GO:0090089  P:regulation of dipeptide transport  
GO:0120174  P:stress-induced homeostatically regulated protein degradation pathway  
GO:0031509  P:subtelomeric heterochromatin formation  
GO:0000722  P:telomere maintenance via recombination  
GO:0006366  P:transcription by RNA polymerase II  
GO:0030433  P:ubiquitin-dependent ERAD pathway  
GO:0071596  P:ubiquitin-dependent protein catabolic process via the N-end rule pathway  
KEGG ppa:PAS_chr3_0359  -  
Pfam View protein in Pfam  
PF00179  UQ_con  
PROSITE View protein in PROSITE  
PS00183  UBC_1  
PS50127  UBC_2  
CDD cd00195  UBCc  
Amino Acid Sequences MSTPARRRLMRDFKRIQQDAPGGVSASPLPDNVMTWNAVIVGPADTPFEDGTFRLVIQFDEQYPNKPPSVKFISDMFHPNVYASGDLCLDILQNRWTPTYDVSSILTSIQSLLNDPNISSPANVEAANLYKDHRSQYIQRVRDTVEKSWSEDILDEDEDDEDEDEGEVDNEDAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.77
3 0.67
4 0.64
5 0.59
6 0.5
7 0.45
8 0.37
9 0.27
10 0.24
11 0.24
12 0.16
13 0.13
14 0.11
15 0.09
16 0.1
17 0.09
18 0.1
19 0.11
20 0.12
21 0.11
22 0.11
23 0.11
24 0.1
25 0.09
26 0.09
27 0.07
28 0.07
29 0.06
30 0.07
31 0.07
32 0.07
33 0.08
34 0.08
35 0.08
36 0.08
37 0.08
38 0.1
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.1
45 0.11
46 0.1
47 0.16
48 0.17
49 0.19
50 0.22
51 0.24
52 0.23
53 0.25
54 0.24
55 0.25
56 0.31
57 0.29
58 0.28
59 0.28
60 0.28
61 0.27
62 0.31
63 0.25
64 0.19
65 0.18
66 0.16
67 0.14
68 0.13
69 0.11
70 0.07
71 0.06
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.05
78 0.06
79 0.07
80 0.09
81 0.09
82 0.1
83 0.11
84 0.12
85 0.13
86 0.16
87 0.15
88 0.14
89 0.15
90 0.14
91 0.14
92 0.13
93 0.11
94 0.08
95 0.08
96 0.08
97 0.06
98 0.07
99 0.07
100 0.09
101 0.09
102 0.1
103 0.1
104 0.1
105 0.11
106 0.1
107 0.09
108 0.09
109 0.1
110 0.1
111 0.09
112 0.09
113 0.11
114 0.12
115 0.11
116 0.11
117 0.12
118 0.14
119 0.16
120 0.18
121 0.21
122 0.26
123 0.37
124 0.45
125 0.47
126 0.48
127 0.48
128 0.48
129 0.52
130 0.5
131 0.43
132 0.42
133 0.39
134 0.4
135 0.4
136 0.37
137 0.3
138 0.26
139 0.24
140 0.2
141 0.19
142 0.15
143 0.13
144 0.13
145 0.12
146 0.12
147 0.11
148 0.08
149 0.07
150 0.07
151 0.07
152 0.07
153 0.07
154 0.07