Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UL75

Protein Details
Accession F0UL75   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
68-87MIRSNRKKAAKAKAASKKKAHydrophilic
NLS Segment(s)
PositionSequence
72-87NRKKAAKAKAASKKKA
Subcellular Location(s) cyto 11, mito 9, plas 2, extr 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0016757  F:glycosyltransferase activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MAEKNGINLLPHSIPGPELPLLLAVMPFVDDGHPLHDLFPPRVWAIRIPVILTLLGSAVVGSFLGVVMIRSNRKKAAKAKAASKKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.15
4 0.11
5 0.11
6 0.1
7 0.1
8 0.1
9 0.09
10 0.08
11 0.05
12 0.04
13 0.04
14 0.04
15 0.04
16 0.04
17 0.05
18 0.05
19 0.07
20 0.08
21 0.08
22 0.09
23 0.12
24 0.13
25 0.14
26 0.15
27 0.14
28 0.14
29 0.15
30 0.14
31 0.13
32 0.14
33 0.16
34 0.16
35 0.14
36 0.14
37 0.14
38 0.13
39 0.12
40 0.08
41 0.05
42 0.05
43 0.04
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.02
50 0.02
51 0.03
52 0.03
53 0.03
54 0.05
55 0.09
56 0.16
57 0.2
58 0.23
59 0.31
60 0.36
61 0.43
62 0.5
63 0.57
64 0.61
65 0.65
66 0.72
67 0.75