Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0U952

Protein Details
Accession F0U952    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
31-59VNVPKTRRTYCKSKECRKHTQHKVTQYKAHydrophilic
82-101QTKPVFRKKAKTTKKVVLRLHydrophilic
NLS Segment(s)
PositionSequence
88-92RKKAK
Subcellular Location(s) mito 13, nucl 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MSPAIPSFSLRGAESAGSRKTFSKRYLDKNVNVPKTRRTYCKSKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFRKKAKTTKKVVLRLECTVCKTKAQLALKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.23
4 0.22
5 0.23
6 0.27
7 0.31
8 0.36
9 0.39
10 0.44
11 0.48
12 0.56
13 0.65
14 0.68
15 0.67
16 0.71
17 0.75
18 0.73
19 0.71
20 0.64
21 0.62
22 0.63
23 0.63
24 0.61
25 0.57
26 0.59
27 0.63
28 0.71
29 0.74
30 0.76
31 0.81
32 0.81
33 0.86
34 0.85
35 0.87
36 0.86
37 0.87
38 0.83
39 0.83
40 0.84
41 0.76
42 0.75
43 0.68
44 0.62
45 0.53
46 0.48
47 0.37
48 0.3
49 0.28
50 0.28
51 0.27
52 0.24
53 0.29
54 0.33
55 0.36
56 0.41
57 0.45
58 0.42
59 0.49
60 0.56
61 0.54
62 0.57
63 0.56
64 0.56
65 0.56
66 0.59
67 0.5
68 0.46
69 0.44
70 0.38
71 0.42
72 0.43
73 0.44
74 0.4
75 0.48
76 0.53
77 0.61
78 0.69
79 0.71
80 0.71
81 0.74
82 0.8
83 0.8
84 0.77
85 0.74
86 0.68
87 0.65
88 0.63
89 0.56
90 0.51
91 0.49
92 0.42
93 0.36
94 0.34
95 0.33
96 0.36
97 0.42
98 0.44
99 0.48
100 0.58
101 0.64
102 0.69
103 0.67
104 0.61
105 0.57
106 0.52
107 0.5
108 0.51
109 0.51
110 0.52
111 0.55
112 0.52
113 0.5
114 0.49
115 0.42