Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UC24

Protein Details
Accession F0UC24    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
102-121QERGRDKERRKDVKPKDCQGBasic
NLS Segment(s)
PositionSequence
66-69RRRR
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MDGGRFKNASCTNPRGFLISSRMSRQNGVGEEDLTGLEVRASAVEHNKPKEINQASGKRLLAPSSRRRRKLTEIGTEDDEEGEDRRIVMTVDKTTNGCEAEQERGRDKERRKDVKPKDCQGLRAEVNLSASLSLYEVGSLLVRAWSRRLIRAQQGADSAAAHRARHPRDGGGVFYGLFLAAFPGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.43
3 0.4
4 0.38
5 0.37
6 0.37
7 0.36
8 0.38
9 0.43
10 0.41
11 0.41
12 0.39
13 0.39
14 0.33
15 0.34
16 0.3
17 0.24
18 0.23
19 0.22
20 0.19
21 0.14
22 0.12
23 0.07
24 0.06
25 0.06
26 0.05
27 0.05
28 0.06
29 0.07
30 0.12
31 0.19
32 0.25
33 0.27
34 0.3
35 0.3
36 0.31
37 0.39
38 0.37
39 0.36
40 0.39
41 0.44
42 0.44
43 0.48
44 0.47
45 0.39
46 0.37
47 0.33
48 0.3
49 0.31
50 0.4
51 0.46
52 0.55
53 0.59
54 0.63
55 0.66
56 0.68
57 0.7
58 0.67
59 0.66
60 0.61
61 0.58
62 0.56
63 0.5
64 0.42
65 0.32
66 0.24
67 0.14
68 0.11
69 0.09
70 0.06
71 0.06
72 0.06
73 0.06
74 0.06
75 0.07
76 0.08
77 0.1
78 0.11
79 0.12
80 0.12
81 0.13
82 0.14
83 0.13
84 0.11
85 0.1
86 0.1
87 0.15
88 0.18
89 0.19
90 0.21
91 0.23
92 0.27
93 0.32
94 0.37
95 0.41
96 0.49
97 0.55
98 0.59
99 0.67
100 0.74
101 0.77
102 0.81
103 0.77
104 0.75
105 0.69
106 0.67
107 0.59
108 0.55
109 0.46
110 0.39
111 0.34
112 0.25
113 0.24
114 0.2
115 0.18
116 0.1
117 0.09
118 0.07
119 0.07
120 0.06
121 0.05
122 0.04
123 0.04
124 0.04
125 0.05
126 0.05
127 0.04
128 0.07
129 0.08
130 0.09
131 0.11
132 0.17
133 0.19
134 0.25
135 0.31
136 0.35
137 0.42
138 0.49
139 0.49
140 0.45
141 0.45
142 0.4
143 0.35
144 0.29
145 0.22
146 0.2
147 0.21
148 0.18
149 0.23
150 0.3
151 0.34
152 0.4
153 0.41
154 0.37
155 0.43
156 0.45
157 0.41
158 0.35
159 0.32
160 0.26
161 0.23
162 0.21
163 0.13
164 0.1
165 0.08
166 0.06