Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0U9A1

Protein Details
Accession F0U9A1    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
30-53GDKPTTEKEKRRRGKRVYDIWRLABasic
NLS Segment(s)
PositionSequence
37-45KEKRRRGKR
79-80KR
Subcellular Location(s) mito 12.5, cyto_mito 8.5, nucl 5, extr 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPWGTSLKPTIASSKAGCLCFLFRVDPFLGDKPTTEKEKRRRGKRVYDIWRLATGIADDELDPTLPVARTHPAFGGAKKRRSQRLAGPRIALDNELSLSWLCRHADMYPLPAQDRDTRYLVGFNVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.32
4 0.31
5 0.28
6 0.27
7 0.26
8 0.26
9 0.2
10 0.15
11 0.19
12 0.19
13 0.19
14 0.2
15 0.21
16 0.22
17 0.2
18 0.21
19 0.21
20 0.25
21 0.3
22 0.33
23 0.4
24 0.48
25 0.58
26 0.67
27 0.73
28 0.79
29 0.8
30 0.84
31 0.85
32 0.85
33 0.83
34 0.83
35 0.77
36 0.68
37 0.61
38 0.5
39 0.4
40 0.3
41 0.21
42 0.11
43 0.08
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.04
51 0.05
52 0.05
53 0.05
54 0.06
55 0.09
56 0.09
57 0.1
58 0.1
59 0.13
60 0.14
61 0.16
62 0.26
63 0.3
64 0.36
65 0.41
66 0.47
67 0.52
68 0.55
69 0.57
70 0.56
71 0.61
72 0.63
73 0.61
74 0.56
75 0.49
76 0.47
77 0.43
78 0.33
79 0.23
80 0.15
81 0.12
82 0.1
83 0.1
84 0.08
85 0.09
86 0.09
87 0.12
88 0.12
89 0.12
90 0.14
91 0.13
92 0.2
93 0.2
94 0.24
95 0.25
96 0.27
97 0.27
98 0.27
99 0.3
100 0.31
101 0.34
102 0.34
103 0.32
104 0.31
105 0.31
106 0.33