Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F0U5Y7

Protein Details
Accession F0U5Y7    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
149-173GSIAEDKLKDKKKHKHSNSGGHHSHBasic
NLS Segment(s)
PositionSequence
159-163KKKHK
Subcellular Location(s) nucl 20, cyto_nucl 13, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008816  Gly_zipper_2TM_dom  
Gene Ontology GO:0019867  C:outer membrane  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF05433  Rick_17kDa_Anti  
Amino Acid Sequences MSGPYDNQNNPNYYGQGGYPPQQGYGQAPPDQYNQGQYPPQQGYGQPAYGQQHPPQQHGNEQQGYYGQHQQQQPYDPNQQGYPQQPHQQPQYDNQGVAQQHQQQAGAPGGAQDGERGLGGALTGGLAGGFMGHQANHGILGTIGGAILGSIAEDKLKDKKKHKHSNSGGHHSHGGSHHGGSQYGGGGSSNFLGSAAGSLFGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.24
3 0.26
4 0.25
5 0.25
6 0.27
7 0.26
8 0.27
9 0.26
10 0.27
11 0.25
12 0.28
13 0.29
14 0.27
15 0.28
16 0.29
17 0.31
18 0.34
19 0.3
20 0.29
21 0.26
22 0.27
23 0.28
24 0.28
25 0.32
26 0.3
27 0.32
28 0.28
29 0.27
30 0.3
31 0.3
32 0.29
33 0.22
34 0.24
35 0.25
36 0.28
37 0.3
38 0.27
39 0.32
40 0.33
41 0.35
42 0.37
43 0.36
44 0.39
45 0.42
46 0.45
47 0.41
48 0.39
49 0.36
50 0.33
51 0.33
52 0.28
53 0.29
54 0.24
55 0.26
56 0.28
57 0.31
58 0.31
59 0.34
60 0.35
61 0.33
62 0.38
63 0.34
64 0.33
65 0.31
66 0.31
67 0.3
68 0.31
69 0.32
70 0.29
71 0.35
72 0.36
73 0.39
74 0.42
75 0.43
76 0.39
77 0.38
78 0.43
79 0.37
80 0.34
81 0.31
82 0.3
83 0.25
84 0.25
85 0.25
86 0.19
87 0.2
88 0.2
89 0.2
90 0.16
91 0.17
92 0.16
93 0.12
94 0.08
95 0.06
96 0.06
97 0.06
98 0.06
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.03
106 0.03
107 0.03
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.03
119 0.03
120 0.04
121 0.04
122 0.05
123 0.05
124 0.05
125 0.05
126 0.04
127 0.05
128 0.04
129 0.04
130 0.03
131 0.03
132 0.03
133 0.02
134 0.02
135 0.02
136 0.02
137 0.02
138 0.03
139 0.03
140 0.04
141 0.07
142 0.15
143 0.25
144 0.33
145 0.43
146 0.53
147 0.64
148 0.75
149 0.82
150 0.84
151 0.85
152 0.87
153 0.87
154 0.87
155 0.78
156 0.7
157 0.64
158 0.53
159 0.47
160 0.38
161 0.33
162 0.25
163 0.23
164 0.24
165 0.22
166 0.22
167 0.19
168 0.18
169 0.15
170 0.13
171 0.12
172 0.09
173 0.08
174 0.09
175 0.09
176 0.08
177 0.07
178 0.07
179 0.07
180 0.06
181 0.07
182 0.07
183 0.07