Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0U815

Protein Details
Accession F0U815   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKASRKTKARSIEKKKKDPNAPKRGLSBasic
NLS Segment(s)
PositionSequence
3-27KEKASRKTKARSIEKKKKDPNAPKR
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKASRKTKARSIEKKKKDPNAPKRGLSAYMFFANEQRENVREENPGISFGQVGKVLGERWKALNEKQRAPYEAKAAADKKRYEDEKASYNAQDEDDESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.88
4 0.89
5 0.91
6 0.9
7 0.9
8 0.9
9 0.9
10 0.9
11 0.86
12 0.77
13 0.73
14 0.65
15 0.58
16 0.48
17 0.39
18 0.31
19 0.27
20 0.25
21 0.2
22 0.2
23 0.2
24 0.18
25 0.17
26 0.16
27 0.15
28 0.17
29 0.19
30 0.18
31 0.17
32 0.17
33 0.17
34 0.16
35 0.16
36 0.13
37 0.12
38 0.1
39 0.08
40 0.09
41 0.07
42 0.07
43 0.06
44 0.07
45 0.07
46 0.1
47 0.11
48 0.11
49 0.12
50 0.15
51 0.17
52 0.22
53 0.3
54 0.33
55 0.39
56 0.45
57 0.47
58 0.47
59 0.49
60 0.46
61 0.42
62 0.4
63 0.35
64 0.35
65 0.35
66 0.38
67 0.41
68 0.4
69 0.39
70 0.44
71 0.46
72 0.45
73 0.47
74 0.46
75 0.46
76 0.49
77 0.48
78 0.41
79 0.4
80 0.36
81 0.31
82 0.27