Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V3Y5

Protein Details
Accession Q0V3Y5   
Localization Confidence Low
Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
506-525VPSHSPRSPRSPLKRGAIREHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9, cyto_nucl 8.5, cysk 7, nucl 6, pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019154  Arb2_domain  
IPR000286  His_deacetylse  
IPR023801  His_deacetylse_dom  
IPR037138  His_deacetylse_dom_sf  
IPR017320  Histone_deAcase_II_euk  
IPR023696  Ureohydrolase_dom_sf  
Gene Ontology GO:0099115  C:chromosome, subtelomeric region  
GO:0070823  C:HDA1 complex  
GO:1990342  C:heterochromatin island  
GO:0000118  C:histone deacetylase complex  
GO:0031934  C:mating-type region heterochromatin  
GO:0005730  C:nucleolus  
GO:0005721  C:pericentric heterochromatin  
GO:0033553  C:rDNA heterochromatin  
GO:0070824  C:SHREC complex  
GO:0110129  C:SHREC2 complex  
GO:0003682  F:chromatin binding  
GO:0004407  F:histone deacetylase activity  
GO:0031078  F:histone H3K14 deacetylase activity  
GO:0042802  F:identical protein binding  
GO:0016575  P:histone deacetylation  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0010621  P:negative regulation of transcription by transcription factor localization  
GO:0090053  P:positive regulation of pericentric heterochromatin formation  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0000183  P:rDNA heterochromatin formation  
GO:0030466  P:silent mating-type cassette heterochromatin formation  
KEGG pno:SNOG_01279  -  
Pfam View protein in Pfam  
PF09757  Arb2  
PF00850  Hist_deacetyl  
Amino Acid Sequences MKSEQLKFEAEQLDSIYFNQATFECAKLAAGGAIEACKAVVQGSVRNAIAIVRPPGHHAESNQPSGFCIFNNVPIATRVCQEAYPETCRKVMILDWDVHHGNGIQHAFYNDPNVLYISLHVFRGGNFYPNLPDGDLDYSGEGPGEGKNVNIPWADHGMGDAEYLYAFQEVVMPIATEFDPDLVIISAGFDAAEGDILGGCFVTPAAYGHMTHMLMRLARGKLVVCLEGGYNLRSIARSALAVTRVLMLEPPDRLQEDMPAPKDSAVYTIEQVKRQHSRYWKCMYPKHLDKSDPGYKNTHRLHEVVREWQSLRLSQDHAMTPLPLTINRTGLAQTFEHNVIATPHDATQVFFMGIGDAYAGLVDLLSNYEPDSVVECLIGFVAETTIQSIKRPTDDTIALWYHAHSKIFVKNSHFVWDPSRQLDKEDTLDAMLEAHMEDVQKLLLEKTAEYAEMNDVSSLTDDQIPATGPLRSPPALARAFTPRVRQESMSDALKSPKLPAVGFFSVPSHSPRSPRSPLKRGAIRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.21
4 0.17
5 0.16
6 0.17
7 0.14
8 0.17
9 0.18
10 0.18
11 0.15
12 0.15
13 0.15
14 0.13
15 0.13
16 0.11
17 0.09
18 0.08
19 0.08
20 0.08
21 0.08
22 0.08
23 0.07
24 0.06
25 0.06
26 0.06
27 0.08
28 0.1
29 0.14
30 0.18
31 0.23
32 0.22
33 0.22
34 0.22
35 0.2
36 0.22
37 0.22
38 0.23
39 0.21
40 0.22
41 0.26
42 0.31
43 0.33
44 0.33
45 0.31
46 0.37
47 0.41
48 0.47
49 0.44
50 0.39
51 0.36
52 0.35
53 0.33
54 0.23
55 0.23
56 0.17
57 0.2
58 0.24
59 0.24
60 0.23
61 0.25
62 0.28
63 0.23
64 0.23
65 0.21
66 0.18
67 0.18
68 0.2
69 0.24
70 0.26
71 0.32
72 0.34
73 0.34
74 0.34
75 0.34
76 0.31
77 0.26
78 0.24
79 0.25
80 0.25
81 0.26
82 0.26
83 0.31
84 0.31
85 0.29
86 0.27
87 0.2
88 0.17
89 0.18
90 0.18
91 0.13
92 0.14
93 0.15
94 0.15
95 0.14
96 0.17
97 0.13
98 0.12
99 0.13
100 0.13
101 0.12
102 0.11
103 0.12
104 0.12
105 0.13
106 0.13
107 0.13
108 0.13
109 0.12
110 0.18
111 0.17
112 0.17
113 0.16
114 0.17
115 0.19
116 0.2
117 0.21
118 0.15
119 0.15
120 0.13
121 0.15
122 0.14
123 0.12
124 0.12
125 0.11
126 0.1
127 0.1
128 0.08
129 0.06
130 0.06
131 0.07
132 0.07
133 0.06
134 0.09
135 0.09
136 0.12
137 0.12
138 0.12
139 0.12
140 0.15
141 0.16
142 0.13
143 0.13
144 0.12
145 0.11
146 0.11
147 0.08
148 0.05
149 0.05
150 0.05
151 0.05
152 0.04
153 0.04
154 0.04
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.08
162 0.08
163 0.06
164 0.06
165 0.06
166 0.06
167 0.06
168 0.06
169 0.05
170 0.05
171 0.04
172 0.04
173 0.04
174 0.04
175 0.04
176 0.03
177 0.03
178 0.03
179 0.03
180 0.03
181 0.03
182 0.03
183 0.03
184 0.03
185 0.03
186 0.03
187 0.02
188 0.02
189 0.03
190 0.03
191 0.03
192 0.06
193 0.07
194 0.07
195 0.08
196 0.11
197 0.11
198 0.11
199 0.12
200 0.11
201 0.1
202 0.11
203 0.15
204 0.13
205 0.13
206 0.13
207 0.12
208 0.13
209 0.14
210 0.14
211 0.09
212 0.09
213 0.09
214 0.1
215 0.11
216 0.09
217 0.08
218 0.08
219 0.08
220 0.08
221 0.08
222 0.07
223 0.07
224 0.06
225 0.07
226 0.09
227 0.09
228 0.09
229 0.09
230 0.09
231 0.09
232 0.08
233 0.08
234 0.08
235 0.08
236 0.09
237 0.09
238 0.09
239 0.1
240 0.11
241 0.1
242 0.12
243 0.14
244 0.17
245 0.18
246 0.18
247 0.18
248 0.17
249 0.18
250 0.15
251 0.13
252 0.11
253 0.09
254 0.09
255 0.16
256 0.18
257 0.21
258 0.23
259 0.26
260 0.31
261 0.32
262 0.37
263 0.4
264 0.44
265 0.48
266 0.53
267 0.53
268 0.54
269 0.57
270 0.57
271 0.57
272 0.58
273 0.57
274 0.56
275 0.52
276 0.48
277 0.51
278 0.54
279 0.48
280 0.42
281 0.42
282 0.39
283 0.47
284 0.47
285 0.43
286 0.36
287 0.35
288 0.35
289 0.37
290 0.37
291 0.34
292 0.34
293 0.33
294 0.31
295 0.32
296 0.3
297 0.25
298 0.25
299 0.2
300 0.2
301 0.19
302 0.21
303 0.19
304 0.19
305 0.17
306 0.16
307 0.13
308 0.13
309 0.11
310 0.09
311 0.12
312 0.12
313 0.13
314 0.13
315 0.14
316 0.13
317 0.13
318 0.15
319 0.12
320 0.12
321 0.14
322 0.14
323 0.13
324 0.13
325 0.12
326 0.1
327 0.11
328 0.1
329 0.09
330 0.09
331 0.11
332 0.11
333 0.11
334 0.11
335 0.11
336 0.1
337 0.09
338 0.08
339 0.06
340 0.06
341 0.05
342 0.04
343 0.03
344 0.03
345 0.03
346 0.03
347 0.02
348 0.02
349 0.02
350 0.02
351 0.03
352 0.04
353 0.04
354 0.05
355 0.05
356 0.05
357 0.06
358 0.08
359 0.08
360 0.08
361 0.08
362 0.07
363 0.07
364 0.07
365 0.06
366 0.04
367 0.03
368 0.04
369 0.04
370 0.04
371 0.06
372 0.08
373 0.09
374 0.1
375 0.13
376 0.15
377 0.17
378 0.2
379 0.2
380 0.23
381 0.24
382 0.24
383 0.27
384 0.26
385 0.24
386 0.22
387 0.21
388 0.21
389 0.22
390 0.21
391 0.17
392 0.19
393 0.25
394 0.3
395 0.34
396 0.34
397 0.37
398 0.38
399 0.41
400 0.39
401 0.35
402 0.35
403 0.37
404 0.35
405 0.36
406 0.41
407 0.36
408 0.37
409 0.4
410 0.37
411 0.33
412 0.31
413 0.26
414 0.2
415 0.2
416 0.17
417 0.13
418 0.1
419 0.07
420 0.06
421 0.06
422 0.06
423 0.06
424 0.06
425 0.06
426 0.07
427 0.07
428 0.08
429 0.08
430 0.1
431 0.1
432 0.11
433 0.13
434 0.14
435 0.13
436 0.13
437 0.14
438 0.14
439 0.14
440 0.14
441 0.12
442 0.11
443 0.11
444 0.12
445 0.11
446 0.1
447 0.11
448 0.1
449 0.11
450 0.11
451 0.12
452 0.12
453 0.13
454 0.13
455 0.12
456 0.15
457 0.19
458 0.19
459 0.2
460 0.21
461 0.27
462 0.28
463 0.28
464 0.29
465 0.32
466 0.38
467 0.4
468 0.46
469 0.45
470 0.48
471 0.52
472 0.5
473 0.45
474 0.45
475 0.47
476 0.43
477 0.38
478 0.35
479 0.36
480 0.37
481 0.34
482 0.31
483 0.3
484 0.28
485 0.26
486 0.27
487 0.31
488 0.31
489 0.31
490 0.29
491 0.27
492 0.26
493 0.27
494 0.28
495 0.26
496 0.27
497 0.32
498 0.38
499 0.45
500 0.53
501 0.62
502 0.68
503 0.71
504 0.76
505 0.8