Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UE47

Protein Details
Accession F0UE47   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
12-36LSNVAKFVPKRHRKRLRDNIMGITKHydrophilic
NLS Segment(s)
PositionSequence
22-25RHRK
Subcellular Location(s) mito 14, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
Gene Ontology GO:0046982  F:protein heterodimerization activity  
Amino Acid Sequences METINSRHNCNLSNVAKFVPKRHRKRLRDNIMGITKPTIRYVYENPKYLGLLHFKVGDYQNPLESTPFLPRLARRGGVIRIQKDIYDTVRSVVLERLRETVTTRDVSSVHIAWHGKSCLRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.4
4 0.39
5 0.43
6 0.45
7 0.51
8 0.57
9 0.67
10 0.76
11 0.78
12 0.88
13 0.91
14 0.9
15 0.89
16 0.83
17 0.8
18 0.76
19 0.67
20 0.56
21 0.48
22 0.4
23 0.31
24 0.29
25 0.22
26 0.17
27 0.2
28 0.26
29 0.34
30 0.37
31 0.38
32 0.38
33 0.37
34 0.36
35 0.32
36 0.29
37 0.22
38 0.18
39 0.16
40 0.16
41 0.15
42 0.18
43 0.18
44 0.16
45 0.16
46 0.15
47 0.16
48 0.15
49 0.16
50 0.13
51 0.13
52 0.13
53 0.12
54 0.14
55 0.13
56 0.14
57 0.15
58 0.19
59 0.2
60 0.2
61 0.18
62 0.2
63 0.22
64 0.28
65 0.33
66 0.3
67 0.31
68 0.3
69 0.29
70 0.27
71 0.27
72 0.23
73 0.2
74 0.19
75 0.17
76 0.18
77 0.18
78 0.17
79 0.2
80 0.21
81 0.2
82 0.21
83 0.23
84 0.22
85 0.23
86 0.24
87 0.24
88 0.25
89 0.24
90 0.24
91 0.23
92 0.22
93 0.25
94 0.26
95 0.23
96 0.19
97 0.22
98 0.23
99 0.22
100 0.28
101 0.28