Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F0UIA8

Protein Details
Accession F0UIA8    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-117RPGSKDGKNWRARKRRNSEDIRRDKLBasic
162-188YSRRRGARTRTSKTTKRDVPRGPKLGGBasic
NLS Segment(s)
PositionSequence
90-108KARPGSKDGKNWRARKRRN
164-204RRRGARTRTSKTTKRDVPRGPKLGGSRSARAAMREKAAAQK
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR010756  Tls1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF07052  Hep_59  
Amino Acid Sequences MAKRHEKHKNNNTADHHDQLASQAAVRGPTSDLVLPQRQPASLGKLHEIDLGPDAKLRNIERTEAATRRLAGDQVPDEDEDEDKDATSNKARPGSKDGKNWRARKRRNSEDIRRDKLVEEVLRESKLDVYDEPEVVSQQNDEQAADDRIAEQFRRDFLDAIYSRRRGARTRTSKTTKRDVPRGPKLGGSRSARAAMREKAAAQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.68
3 0.59
4 0.49
5 0.42
6 0.34
7 0.31
8 0.22
9 0.17
10 0.16
11 0.15
12 0.16
13 0.16
14 0.15
15 0.12
16 0.13
17 0.15
18 0.13
19 0.15
20 0.19
21 0.23
22 0.23
23 0.26
24 0.26
25 0.24
26 0.26
27 0.26
28 0.27
29 0.26
30 0.27
31 0.26
32 0.26
33 0.27
34 0.28
35 0.25
36 0.2
37 0.19
38 0.17
39 0.14
40 0.15
41 0.15
42 0.13
43 0.17
44 0.17
45 0.21
46 0.22
47 0.24
48 0.23
49 0.28
50 0.32
51 0.3
52 0.31
53 0.26
54 0.25
55 0.26
56 0.25
57 0.2
58 0.15
59 0.17
60 0.15
61 0.15
62 0.15
63 0.13
64 0.13
65 0.13
66 0.13
67 0.1
68 0.1
69 0.09
70 0.08
71 0.08
72 0.08
73 0.09
74 0.12
75 0.15
76 0.16
77 0.23
78 0.24
79 0.26
80 0.33
81 0.4
82 0.42
83 0.48
84 0.52
85 0.56
86 0.64
87 0.7
88 0.72
89 0.74
90 0.77
91 0.79
92 0.8
93 0.8
94 0.81
95 0.82
96 0.83
97 0.83
98 0.84
99 0.78
100 0.7
101 0.62
102 0.52
103 0.45
104 0.39
105 0.3
106 0.23
107 0.22
108 0.22
109 0.21
110 0.21
111 0.19
112 0.16
113 0.15
114 0.14
115 0.1
116 0.12
117 0.13
118 0.14
119 0.14
120 0.12
121 0.12
122 0.11
123 0.11
124 0.08
125 0.07
126 0.09
127 0.09
128 0.09
129 0.09
130 0.11
131 0.12
132 0.12
133 0.11
134 0.1
135 0.11
136 0.13
137 0.12
138 0.12
139 0.13
140 0.14
141 0.18
142 0.19
143 0.18
144 0.17
145 0.26
146 0.25
147 0.29
148 0.35
149 0.32
150 0.33
151 0.36
152 0.39
153 0.35
154 0.42
155 0.48
156 0.51
157 0.58
158 0.67
159 0.72
160 0.77
161 0.78
162 0.8
163 0.78
164 0.77
165 0.79
166 0.78
167 0.8
168 0.82
169 0.81
170 0.73
171 0.7
172 0.65
173 0.62
174 0.61
175 0.56
176 0.5
177 0.47
178 0.51
179 0.46
180 0.46
181 0.46
182 0.42
183 0.4
184 0.39