Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UPJ1

Protein Details
Accession Q0UPJ1   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
291-315EDKLREIEKERERNKRPGRSGSVKTBasic
NLS Segment(s)
PositionSequence
300-308ERERNKRPG
Subcellular Location(s) cyto_nucl 11.833, nucl 10.5, cyto_mito 8.665, cyto 8, mito 7.5
Family & Domain DBs
KEGG pno:SNOG_06323  -  
Amino Acid Sequences MAVAEEKTISRSSHVADPALAPFLEYKFDPAEYLNATLPALSLSSASARPLKSANAVSLADLSSQTQDLLSQLNAHTTRLSAILTQLTDDILRSGARLAYEVEVLRGETISLTETFTTDLKDDVEKFLPGGIKLPTEQKDEALKSPALPTEPSPSQPPQPQDPPPDSTPEYISDLRTLTTVRTRLETVIKVFGEAMHWTLPPSEISLTSSLISVSAPEPGSDNASQEQKGKEFAAALRSEIADLITGDPEGGREKAEVRIQALRDLAQVWKGTAEEKARGKFVEGLVRVAEDKLREIEKERERNKRPGRSGSVKTAQTPAVPQQKSGGGFLENLQRIRGFVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.28
3 0.27
4 0.28
5 0.27
6 0.26
7 0.22
8 0.16
9 0.15
10 0.15
11 0.16
12 0.14
13 0.16
14 0.15
15 0.16
16 0.16
17 0.16
18 0.18
19 0.18
20 0.2
21 0.18
22 0.17
23 0.16
24 0.15
25 0.14
26 0.11
27 0.09
28 0.07
29 0.06
30 0.06
31 0.09
32 0.1
33 0.12
34 0.16
35 0.16
36 0.18
37 0.2
38 0.21
39 0.24
40 0.25
41 0.24
42 0.24
43 0.24
44 0.22
45 0.22
46 0.2
47 0.16
48 0.14
49 0.13
50 0.1
51 0.1
52 0.09
53 0.08
54 0.08
55 0.08
56 0.09
57 0.09
58 0.1
59 0.1
60 0.16
61 0.17
62 0.17
63 0.17
64 0.15
65 0.16
66 0.15
67 0.15
68 0.09
69 0.1
70 0.12
71 0.11
72 0.12
73 0.11
74 0.1
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.07
82 0.08
83 0.08
84 0.08
85 0.09
86 0.09
87 0.11
88 0.11
89 0.11
90 0.1
91 0.1
92 0.09
93 0.08
94 0.07
95 0.05
96 0.05
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.09
104 0.09
105 0.08
106 0.08
107 0.09
108 0.11
109 0.11
110 0.13
111 0.14
112 0.13
113 0.13
114 0.14
115 0.14
116 0.12
117 0.14
118 0.12
119 0.11
120 0.12
121 0.18
122 0.18
123 0.21
124 0.22
125 0.22
126 0.26
127 0.27
128 0.27
129 0.25
130 0.23
131 0.19
132 0.2
133 0.19
134 0.15
135 0.14
136 0.14
137 0.16
138 0.17
139 0.18
140 0.2
141 0.21
142 0.24
143 0.28
144 0.29
145 0.29
146 0.33
147 0.36
148 0.37
149 0.38
150 0.39
151 0.35
152 0.37
153 0.33
154 0.29
155 0.25
156 0.22
157 0.23
158 0.2
159 0.19
160 0.16
161 0.15
162 0.14
163 0.13
164 0.11
165 0.09
166 0.12
167 0.14
168 0.13
169 0.15
170 0.15
171 0.17
172 0.2
173 0.2
174 0.18
175 0.2
176 0.19
177 0.17
178 0.17
179 0.15
180 0.13
181 0.11
182 0.11
183 0.08
184 0.08
185 0.08
186 0.08
187 0.09
188 0.08
189 0.08
190 0.08
191 0.07
192 0.09
193 0.1
194 0.1
195 0.1
196 0.1
197 0.08
198 0.08
199 0.07
200 0.07
201 0.06
202 0.08
203 0.08
204 0.08
205 0.09
206 0.1
207 0.14
208 0.13
209 0.14
210 0.14
211 0.16
212 0.17
213 0.19
214 0.21
215 0.18
216 0.2
217 0.19
218 0.17
219 0.16
220 0.16
221 0.19
222 0.17
223 0.17
224 0.16
225 0.15
226 0.15
227 0.13
228 0.12
229 0.07
230 0.07
231 0.07
232 0.06
233 0.06
234 0.06
235 0.06
236 0.06
237 0.08
238 0.08
239 0.08
240 0.08
241 0.1
242 0.15
243 0.19
244 0.19
245 0.2
246 0.25
247 0.25
248 0.27
249 0.27
250 0.23
251 0.2
252 0.2
253 0.18
254 0.16
255 0.16
256 0.13
257 0.13
258 0.13
259 0.13
260 0.17
261 0.19
262 0.22
263 0.28
264 0.3
265 0.31
266 0.31
267 0.33
268 0.32
269 0.32
270 0.34
271 0.29
272 0.28
273 0.27
274 0.27
275 0.26
276 0.22
277 0.21
278 0.13
279 0.15
280 0.17
281 0.18
282 0.18
283 0.23
284 0.32
285 0.39
286 0.49
287 0.55
288 0.62
289 0.67
290 0.76
291 0.81
292 0.82
293 0.8
294 0.8
295 0.82
296 0.8
297 0.8
298 0.79
299 0.77
300 0.69
301 0.64
302 0.58
303 0.5
304 0.43
305 0.4
306 0.4
307 0.41
308 0.39
309 0.37
310 0.37
311 0.4
312 0.4
313 0.37
314 0.31
315 0.22
316 0.23
317 0.25
318 0.31
319 0.3
320 0.28
321 0.29
322 0.27