Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UPD7

Protein Details
Accession Q0UPD7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
18-37LPPLPKLRVRRPNKPEANPCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
KEGG pno:SNOG_06377  -  
Amino Acid Sequences MVPKPQGSAVQSATHRPLPPLPKLRVRRPNKPEANPCLGVMSSVLGCWASSGYSVQGCAQLEQKLRQCMDAPRDTNVKKNNINYHLSRMYPKIKGPHKRD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.32
4 0.36
5 0.36
6 0.43
7 0.48
8 0.49
9 0.54
10 0.61
11 0.69
12 0.72
13 0.74
14 0.76
15 0.75
16 0.8
17 0.79
18 0.8
19 0.79
20 0.75
21 0.75
22 0.65
23 0.57
24 0.48
25 0.38
26 0.29
27 0.21
28 0.14
29 0.07
30 0.06
31 0.06
32 0.04
33 0.04
34 0.04
35 0.04
36 0.03
37 0.03
38 0.04
39 0.05
40 0.05
41 0.05
42 0.06
43 0.08
44 0.09
45 0.09
46 0.11
47 0.14
48 0.17
49 0.21
50 0.25
51 0.28
52 0.28
53 0.28
54 0.29
55 0.31
56 0.36
57 0.39
58 0.36
59 0.35
60 0.42
61 0.42
62 0.47
63 0.48
64 0.48
65 0.46
66 0.52
67 0.57
68 0.55
69 0.6
70 0.55
71 0.57
72 0.53
73 0.5
74 0.46
75 0.44
76 0.44
77 0.42
78 0.45
79 0.47
80 0.53