Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0S049

Protein Details
Accession G0S049    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
116-144DHDKGGCSHRRRQKQRKRNPSPNAYERMPBasic
NLS Segment(s)
PositionSequence
125-154RRRQKQRKRNPSPNAYERMPRYDKKPSKSK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0032515  P:negative regulation of phosphoprotein phosphatase activity  
KEGG cthr:CTHT_0008740  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MAPPAEGSTRQILPPTGSLTQTHTTPSTEIQQNQTETHPPAILRLRGAHAPSNRSVTWRSDVVDNEGLNKKKSKVCCIYHRPHSIDSSSEEDSSSSSSSDSDSDDSSGGRKVPDADHDKGGCSHRRRQKQRKRNPSPNAYERMPRYDKKPSKSKVSGSGGGDGGSGGFRPGKDGNGDPNGGSGPSGPQAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.24
4 0.23
5 0.24
6 0.27
7 0.28
8 0.26
9 0.26
10 0.23
11 0.22
12 0.22
13 0.23
14 0.25
15 0.29
16 0.31
17 0.33
18 0.37
19 0.38
20 0.38
21 0.38
22 0.35
23 0.31
24 0.3
25 0.27
26 0.21
27 0.24
28 0.28
29 0.27
30 0.25
31 0.24
32 0.25
33 0.27
34 0.29
35 0.3
36 0.28
37 0.31
38 0.31
39 0.34
40 0.32
41 0.31
42 0.31
43 0.29
44 0.29
45 0.26
46 0.25
47 0.23
48 0.24
49 0.26
50 0.28
51 0.24
52 0.25
53 0.29
54 0.3
55 0.28
56 0.3
57 0.28
58 0.29
59 0.32
60 0.37
61 0.4
62 0.45
63 0.53
64 0.6
65 0.64
66 0.68
67 0.72
68 0.66
69 0.59
70 0.54
71 0.45
72 0.37
73 0.32
74 0.27
75 0.22
76 0.19
77 0.17
78 0.15
79 0.14
80 0.13
81 0.11
82 0.07
83 0.06
84 0.06
85 0.06
86 0.07
87 0.08
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.09
95 0.08
96 0.07
97 0.08
98 0.09
99 0.09
100 0.17
101 0.22
102 0.24
103 0.28
104 0.28
105 0.28
106 0.3
107 0.33
108 0.33
109 0.32
110 0.38
111 0.43
112 0.54
113 0.64
114 0.72
115 0.79
116 0.83
117 0.9
118 0.92
119 0.94
120 0.94
121 0.93
122 0.91
123 0.89
124 0.86
125 0.81
126 0.72
127 0.68
128 0.6
129 0.59
130 0.55
131 0.48
132 0.46
133 0.51
134 0.56
135 0.58
136 0.65
137 0.62
138 0.67
139 0.71
140 0.7
141 0.69
142 0.68
143 0.66
144 0.58
145 0.56
146 0.46
147 0.39
148 0.34
149 0.23
150 0.17
151 0.11
152 0.08
153 0.06
154 0.08
155 0.07
156 0.12
157 0.13
158 0.16
159 0.19
160 0.22
161 0.29
162 0.32
163 0.33
164 0.29
165 0.29
166 0.27
167 0.23
168 0.21
169 0.14
170 0.11