Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SG72

Protein Details
Accession G0SG72   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
135-160VKQLAAAKQRQKRKKKEEEAAEKARLHydrophilic
NLS Segment(s)
PositionSequence
141-172AKQRQKRKKKEEEAAEKARLAYAKRFDKKIRG
Subcellular Location(s) cyto 15, cyto_nucl 14, nucl 11
Family & Domain DBs
KEGG cthr:CTHT_0065280  -  
Amino Acid Sequences MGTLPTLPKEVDGESGFLTASDVEPEEAGTTPGTGNGIVKGGVVVTADGSSTSPSGQGQIVHVNGLPVVVSKKMLKARRLATSLNIAHSQPRIRPPSIYNAVNPTIINPAVRSRASLLLYPGRPLTHTTHTRLSVKQLAAAKQRQKRKKKEEEAAEKARLAYAKRFDKKIRGDKVVQVDFRKRVRLWMKGVQAAIGEEGFGEVEFDGEGLPIYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.18
3 0.16
4 0.14
5 0.14
6 0.09
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.08
13 0.09
14 0.09
15 0.09
16 0.08
17 0.08
18 0.07
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.08
25 0.08
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.05
32 0.05
33 0.05
34 0.05
35 0.05
36 0.05
37 0.06
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.09
44 0.09
45 0.1
46 0.14
47 0.14
48 0.14
49 0.13
50 0.12
51 0.11
52 0.1
53 0.08
54 0.05
55 0.06
56 0.06
57 0.08
58 0.08
59 0.14
60 0.21
61 0.27
62 0.29
63 0.35
64 0.39
65 0.44
66 0.46
67 0.42
68 0.37
69 0.39
70 0.37
71 0.32
72 0.29
73 0.23
74 0.22
75 0.23
76 0.23
77 0.18
78 0.24
79 0.26
80 0.26
81 0.28
82 0.28
83 0.34
84 0.38
85 0.36
86 0.3
87 0.29
88 0.29
89 0.28
90 0.26
91 0.18
92 0.14
93 0.13
94 0.12
95 0.09
96 0.1
97 0.12
98 0.12
99 0.12
100 0.12
101 0.15
102 0.16
103 0.16
104 0.17
105 0.19
106 0.2
107 0.2
108 0.19
109 0.16
110 0.15
111 0.18
112 0.2
113 0.22
114 0.26
115 0.29
116 0.32
117 0.36
118 0.38
119 0.36
120 0.36
121 0.34
122 0.3
123 0.31
124 0.3
125 0.32
126 0.36
127 0.42
128 0.46
129 0.47
130 0.57
131 0.62
132 0.69
133 0.75
134 0.79
135 0.83
136 0.85
137 0.87
138 0.88
139 0.88
140 0.87
141 0.83
142 0.74
143 0.64
144 0.54
145 0.46
146 0.38
147 0.3
148 0.27
149 0.29
150 0.36
151 0.41
152 0.47
153 0.5
154 0.56
155 0.64
156 0.68
157 0.68
158 0.64
159 0.63
160 0.64
161 0.69
162 0.66
163 0.61
164 0.58
165 0.57
166 0.57
167 0.57
168 0.57
169 0.48
170 0.51
171 0.53
172 0.55
173 0.55
174 0.56
175 0.59
176 0.57
177 0.56
178 0.48
179 0.41
180 0.34
181 0.28
182 0.19
183 0.13
184 0.08
185 0.08
186 0.07
187 0.06
188 0.06
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.04