Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0TVB9

Protein Details
Accession Q0TVB9    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
242-261QASLDKRKDKLKMKSSVKADHydrophilic
NLS Segment(s)
PositionSequence
246-255DKRKDKLKMK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 1, pero 1, E.R. 1, golg 1
Family & Domain DBs
KEGG pno:SNOG_16545  -  
Amino Acid Sequences MSDAAFFAMLCDVQLRTDRSATFESRTFFSSEAPIQHLIEESSLTFAPGLADMIRSPDAPSVQQLRVCSVPLSLDDLTLKWIVYLQYYRKGPLWAIYCGKTTNARGSQERVMEYEYERSNIPDSIKDLLQRGFERTSHTNLAAVDISFEGEDMICVVALVKALEATFATGFWAYSKPTLISLTPLRFWEEVPWLGLCSHSSLMEITFAGLEDDLPNLDELRLAWKERAELATKKYRNPEKGQASLDKRKDKLKMKSSVKAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.2
4 0.24
5 0.24
6 0.27
7 0.32
8 0.33
9 0.32
10 0.32
11 0.32
12 0.3
13 0.32
14 0.29
15 0.24
16 0.23
17 0.24
18 0.23
19 0.23
20 0.25
21 0.25
22 0.23
23 0.23
24 0.22
25 0.18
26 0.15
27 0.13
28 0.1
29 0.1
30 0.1
31 0.09
32 0.08
33 0.08
34 0.08
35 0.07
36 0.08
37 0.06
38 0.07
39 0.07
40 0.1
41 0.11
42 0.11
43 0.11
44 0.13
45 0.14
46 0.14
47 0.19
48 0.21
49 0.22
50 0.24
51 0.24
52 0.25
53 0.24
54 0.24
55 0.2
56 0.15
57 0.14
58 0.12
59 0.16
60 0.13
61 0.13
62 0.13
63 0.12
64 0.14
65 0.14
66 0.13
67 0.08
68 0.09
69 0.09
70 0.11
71 0.15
72 0.16
73 0.23
74 0.24
75 0.25
76 0.26
77 0.26
78 0.24
79 0.26
80 0.26
81 0.23
82 0.25
83 0.25
84 0.25
85 0.24
86 0.25
87 0.23
88 0.21
89 0.24
90 0.26
91 0.27
92 0.28
93 0.31
94 0.33
95 0.32
96 0.31
97 0.25
98 0.21
99 0.19
100 0.18
101 0.19
102 0.16
103 0.15
104 0.14
105 0.14
106 0.14
107 0.15
108 0.15
109 0.11
110 0.13
111 0.13
112 0.14
113 0.14
114 0.15
115 0.15
116 0.17
117 0.16
118 0.17
119 0.17
120 0.17
121 0.2
122 0.21
123 0.23
124 0.22
125 0.21
126 0.2
127 0.19
128 0.19
129 0.15
130 0.12
131 0.09
132 0.07
133 0.07
134 0.06
135 0.06
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.03
148 0.04
149 0.04
150 0.04
151 0.04
152 0.05
153 0.05
154 0.05
155 0.06
156 0.05
157 0.06
158 0.06
159 0.08
160 0.07
161 0.08
162 0.1
163 0.09
164 0.11
165 0.12
166 0.11
167 0.15
168 0.19
169 0.21
170 0.21
171 0.22
172 0.24
173 0.23
174 0.23
175 0.22
176 0.21
177 0.19
178 0.19
179 0.18
180 0.16
181 0.16
182 0.16
183 0.13
184 0.11
185 0.11
186 0.1
187 0.1
188 0.1
189 0.1
190 0.1
191 0.1
192 0.07
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.05
199 0.06
200 0.06
201 0.06
202 0.06
203 0.07
204 0.07
205 0.07
206 0.07
207 0.12
208 0.15
209 0.16
210 0.18
211 0.19
212 0.21
213 0.24
214 0.27
215 0.27
216 0.29
217 0.35
218 0.43
219 0.45
220 0.5
221 0.56
222 0.62
223 0.65
224 0.67
225 0.71
226 0.68
227 0.72
228 0.72
229 0.72
230 0.71
231 0.73
232 0.74
233 0.73
234 0.68
235 0.68
236 0.72
237 0.72
238 0.73
239 0.73
240 0.75
241 0.75