Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SDW1

Protein Details
Accession G0SDW1   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-55PSTPPPTTDQPPKRKRGRPPLSPSKRKPKPQPTGRPRGRPKGSGBasic
119-141AGEQPVKRKRGRPPKNRPAVPVAHydrophilic
NLS Segment(s)
PositionSequence
23-68PKRKRGRPPLSPSKRKPKPQPTGRPRGRPKGSGVKKSKPGPGRPPK
124-136VKRKRGRPPKNRP
Subcellular Location(s) cyto 15, cyto_nucl 13.5, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
KEGG cthr:CTHT_0053190  -  
Amino Acid Sequences MSDQAVPIAAAPSTPPPTTDQPPKRKRGRPPLSPSKRKPKPQPTGRPRGRPKGSGVKKSKPGPGRPPKSAFTTTTTAAAAAAAAAAITEGEEVQTPTSPRKTRGRNSAGAGTVAAATAAGEQPVKRKRGRPPKNRPAVPVAEPAPEKEEELVPLVPLVPPKEPEDEDGEGEIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.22
4 0.28
5 0.35
6 0.45
7 0.5
8 0.57
9 0.66
10 0.75
11 0.8
12 0.82
13 0.86
14 0.86
15 0.86
16 0.85
17 0.86
18 0.88
19 0.89
20 0.91
21 0.9
22 0.9
23 0.89
24 0.88
25 0.89
26 0.88
27 0.88
28 0.89
29 0.91
30 0.9
31 0.92
32 0.9
33 0.9
34 0.87
35 0.87
36 0.81
37 0.73
38 0.7
39 0.7
40 0.69
41 0.69
42 0.68
43 0.65
44 0.68
45 0.69
46 0.69
47 0.66
48 0.65
49 0.66
50 0.69
51 0.68
52 0.67
53 0.67
54 0.62
55 0.61
56 0.56
57 0.47
58 0.41
59 0.37
60 0.31
61 0.27
62 0.25
63 0.19
64 0.15
65 0.13
66 0.08
67 0.05
68 0.04
69 0.02
70 0.02
71 0.02
72 0.02
73 0.01
74 0.02
75 0.02
76 0.02
77 0.02
78 0.03
79 0.03
80 0.04
81 0.05
82 0.06
83 0.09
84 0.16
85 0.17
86 0.22
87 0.31
88 0.39
89 0.45
90 0.54
91 0.58
92 0.56
93 0.58
94 0.57
95 0.49
96 0.41
97 0.34
98 0.24
99 0.18
100 0.13
101 0.09
102 0.04
103 0.03
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.13
110 0.19
111 0.25
112 0.28
113 0.35
114 0.46
115 0.56
116 0.67
117 0.71
118 0.77
119 0.82
120 0.89
121 0.86
122 0.8
123 0.76
124 0.71
125 0.63
126 0.58
127 0.49
128 0.43
129 0.39
130 0.36
131 0.32
132 0.27
133 0.24
134 0.2
135 0.19
136 0.15
137 0.18
138 0.17
139 0.14
140 0.13
141 0.13
142 0.12
143 0.14
144 0.15
145 0.15
146 0.17
147 0.2
148 0.25
149 0.26
150 0.28
151 0.32
152 0.32
153 0.3