Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SFZ4

Protein Details
Accession G0SFZ4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
60-87ADTDGKKDKPKPKLSPKKGKGRGKGKLPBasic
NLS Segment(s)
PositionSequence
65-105KKDKPKPKLSPKKGKGRGKGKLPPKGKGKKTLTPPLPKRGK
Subcellular Location(s) extr 18, E.R. 4, cyto 2, vacu 2
Family & Domain DBs
KEGG cthr:CTHT_0072690  -  
Amino Acid Sequences MQTTTLLLTTLFALPYVTALAVPVANTGAQLGIRAAEPKALPVPDTNPVTIVDVDADTDADTDGKKDKPKPKLSPKKGKGRGKGKLPPKGKGKKTLTPPLPKRGKDEKLENVELTRAEHAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.06
5 0.05
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.06
21 0.07
22 0.07
23 0.09
24 0.09
25 0.1
26 0.13
27 0.12
28 0.13
29 0.13
30 0.15
31 0.19
32 0.2
33 0.19
34 0.17
35 0.17
36 0.18
37 0.17
38 0.14
39 0.09
40 0.07
41 0.07
42 0.06
43 0.06
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.07
51 0.09
52 0.14
53 0.21
54 0.29
55 0.38
56 0.48
57 0.57
58 0.66
59 0.75
60 0.82
61 0.85
62 0.86
63 0.88
64 0.89
65 0.88
66 0.86
67 0.85
68 0.82
69 0.8
70 0.8
71 0.77
72 0.77
73 0.73
74 0.71
75 0.71
76 0.74
77 0.7
78 0.72
79 0.7
80 0.69
81 0.73
82 0.76
83 0.74
84 0.75
85 0.76
86 0.76
87 0.78
88 0.73
89 0.72
90 0.72
91 0.7
92 0.67
93 0.7
94 0.69
95 0.68
96 0.7
97 0.63
98 0.55
99 0.49
100 0.42
101 0.36