Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0S4B5

Protein Details
Accession G0S4B5    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
47-72RGTHSTYCWIRKKRNKVKVYLNKIQEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 8.833, mito_nucl 8.833, mito 7, cyto 6
Family & Domain DBs
KEGG cthr:CTHT_0039580  -  
Amino Acid Sequences MGGQAEEEGSKEEDFKEKDDAEEGMNSEEETEEEGTEVDSAEEVGGRGTHSTYCWIRKKRNKVKVYLNKIQEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.24
4 0.23
5 0.23
6 0.24
7 0.23
8 0.18
9 0.18
10 0.16
11 0.12
12 0.12
13 0.11
14 0.09
15 0.08
16 0.07
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.06
23 0.06
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.04
34 0.04
35 0.05
36 0.06
37 0.06
38 0.12
39 0.16
40 0.25
41 0.34
42 0.41
43 0.52
44 0.61
45 0.72
46 0.78
47 0.84
48 0.83
49 0.83
50 0.86
51 0.87
52 0.87
53 0.84