Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SD22

Protein Details
Accession G0SD22   
Localization Confidence High
Confidence Score 19.4
NoLS Segment(s)
PositionSequenceProtein Nature
6-31KTSPLQPTQCRSPNRRQPNSVQSPGPHydrophilic
134-153AYKLKSKKTIPKKLGAKRTGHydrophilic
355-410GTEKTESRRARMRSRRKKRAAYFRELKARRVAKARRREESKRRLREKRAVLLAQRRBasic
NLS Segment(s)
PositionSequence
137-150LKSKKTIPKKLGAK
361-403SRRARMRSRRKKRAAYFRELKARRVAKARRREESKRRLREKRA
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cthr:CTHT_0050500  -  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MLSQQKTSPLQPTQCRSPNRRQPNSVQSPGPLNPIAAAISTSRSLALPSALIFSVPVAARNVRERQAMQLARLQRPFQRVAGAVASASRPLGALSRPTTTSLEDRFASLRIASPTEINAAVQGKRYATVKSQGAYKLKSKKTIPKKLGAKRTGDQYVLPGNIIYKQRGTVWHPGENTIMGRDHTIHAAVAGYVKYYRDPHRHPGRQYIGVAFNRDDKLPYPPGKRSEEVISPSGIPLTVTRLPESEQSTESEDSTTTGVSVTAQTTVTAKPKLPIHLRRRIPLKDGNSVIARLIQQKLRARAITKAKQDAWRLQQQKELEARMNTRVFRLQDDYSYRETNWEIGRLIGDAGTIPGTEKTESRRARMRSRRKKRAAYFRELKARRVAKARRREESKRRLREKRAVLLAQRREATTTVKATNEAVKVAAEKNKVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.74
3 0.74
4 0.77
5 0.79
6 0.82
7 0.84
8 0.81
9 0.83
10 0.84
11 0.86
12 0.81
13 0.72
14 0.64
15 0.61
16 0.55
17 0.51
18 0.4
19 0.31
20 0.25
21 0.24
22 0.21
23 0.15
24 0.14
25 0.1
26 0.11
27 0.12
28 0.11
29 0.11
30 0.11
31 0.12
32 0.11
33 0.11
34 0.1
35 0.1
36 0.12
37 0.11
38 0.11
39 0.1
40 0.09
41 0.13
42 0.12
43 0.13
44 0.13
45 0.15
46 0.18
47 0.25
48 0.3
49 0.29
50 0.33
51 0.33
52 0.36
53 0.44
54 0.43
55 0.39
56 0.4
57 0.43
58 0.46
59 0.48
60 0.45
61 0.41
62 0.45
63 0.46
64 0.41
65 0.38
66 0.32
67 0.32
68 0.3
69 0.25
70 0.19
71 0.17
72 0.16
73 0.12
74 0.11
75 0.08
76 0.07
77 0.07
78 0.09
79 0.09
80 0.14
81 0.16
82 0.19
83 0.2
84 0.23
85 0.24
86 0.24
87 0.28
88 0.26
89 0.27
90 0.24
91 0.25
92 0.23
93 0.23
94 0.21
95 0.16
96 0.17
97 0.15
98 0.16
99 0.15
100 0.15
101 0.15
102 0.16
103 0.16
104 0.12
105 0.13
106 0.14
107 0.14
108 0.15
109 0.16
110 0.14
111 0.16
112 0.17
113 0.17
114 0.17
115 0.23
116 0.23
117 0.23
118 0.28
119 0.32
120 0.35
121 0.37
122 0.41
123 0.44
124 0.46
125 0.51
126 0.53
127 0.57
128 0.63
129 0.71
130 0.68
131 0.68
132 0.74
133 0.76
134 0.8
135 0.76
136 0.71
137 0.63
138 0.64
139 0.58
140 0.49
141 0.4
142 0.33
143 0.3
144 0.25
145 0.22
146 0.15
147 0.12
148 0.17
149 0.18
150 0.16
151 0.13
152 0.14
153 0.16
154 0.19
155 0.23
156 0.27
157 0.29
158 0.33
159 0.33
160 0.33
161 0.32
162 0.29
163 0.25
164 0.18
165 0.15
166 0.1
167 0.1
168 0.1
169 0.11
170 0.1
171 0.1
172 0.08
173 0.07
174 0.07
175 0.07
176 0.06
177 0.06
178 0.05
179 0.06
180 0.06
181 0.08
182 0.12
183 0.18
184 0.24
185 0.29
186 0.38
187 0.49
188 0.55
189 0.55
190 0.61
191 0.59
192 0.55
193 0.52
194 0.45
195 0.4
196 0.35
197 0.34
198 0.26
199 0.24
200 0.22
201 0.21
202 0.19
203 0.13
204 0.17
205 0.21
206 0.26
207 0.27
208 0.31
209 0.36
210 0.39
211 0.39
212 0.37
213 0.35
214 0.33
215 0.32
216 0.28
217 0.23
218 0.19
219 0.18
220 0.16
221 0.12
222 0.09
223 0.06
224 0.1
225 0.13
226 0.13
227 0.14
228 0.14
229 0.16
230 0.19
231 0.22
232 0.19
233 0.16
234 0.17
235 0.2
236 0.2
237 0.19
238 0.16
239 0.13
240 0.12
241 0.11
242 0.09
243 0.06
244 0.05
245 0.05
246 0.05
247 0.06
248 0.06
249 0.06
250 0.06
251 0.07
252 0.08
253 0.1
254 0.13
255 0.14
256 0.15
257 0.18
258 0.2
259 0.27
260 0.34
261 0.42
262 0.47
263 0.55
264 0.58
265 0.61
266 0.66
267 0.62
268 0.59
269 0.56
270 0.52
271 0.5
272 0.47
273 0.45
274 0.38
275 0.36
276 0.3
277 0.25
278 0.22
279 0.18
280 0.2
281 0.19
282 0.25
283 0.3
284 0.35
285 0.37
286 0.38
287 0.36
288 0.41
289 0.48
290 0.49
291 0.5
292 0.51
293 0.52
294 0.55
295 0.59
296 0.58
297 0.55
298 0.57
299 0.56
300 0.52
301 0.52
302 0.47
303 0.49
304 0.46
305 0.42
306 0.37
307 0.35
308 0.36
309 0.38
310 0.4
311 0.34
312 0.32
313 0.34
314 0.31
315 0.31
316 0.33
317 0.28
318 0.3
319 0.34
320 0.36
321 0.35
322 0.36
323 0.32
324 0.3
325 0.3
326 0.29
327 0.26
328 0.24
329 0.2
330 0.19
331 0.19
332 0.17
333 0.16
334 0.11
335 0.09
336 0.06
337 0.07
338 0.06
339 0.06
340 0.06
341 0.07
342 0.09
343 0.1
344 0.12
345 0.18
346 0.27
347 0.3
348 0.35
349 0.42
350 0.47
351 0.57
352 0.66
353 0.72
354 0.74
355 0.82
356 0.88
357 0.9
358 0.94
359 0.93
360 0.94
361 0.91
362 0.9
363 0.88
364 0.85
365 0.86
366 0.78
367 0.72
368 0.7
369 0.66
370 0.61
371 0.62
372 0.64
373 0.63
374 0.71
375 0.76
376 0.76
377 0.8
378 0.85
379 0.86
380 0.87
381 0.88
382 0.88
383 0.9
384 0.9
385 0.91
386 0.91
387 0.89
388 0.88
389 0.86
390 0.82
391 0.8
392 0.8
393 0.77
394 0.74
395 0.67
396 0.58
397 0.51
398 0.46
399 0.42
400 0.39
401 0.37
402 0.34
403 0.33
404 0.33
405 0.33
406 0.38
407 0.34
408 0.29
409 0.23
410 0.21
411 0.23
412 0.27
413 0.31
414 0.32