Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G0SDM0

Protein Details
Accession G0SDM0    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-35QGTLKKLSKPTKAKANQKPKKGVTKPQKPKLKSHydrophilic
NLS Segment(s)
PositionSequence
7-39KKLSKPTKAKANQKPKKGVTKPQKPKLKSTADK
68-85KGRKKGEEQKYKGGSRKF
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
KEGG cthr:CTHT_0052260  -  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGTLKKLSKPTKAKANQKPKKGVTKPQKPKLKSTADKVAKKLTFGLVSRTEEMLGERAGHLELIGKGRKKGEEQKYKGGSRKFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.79
3 0.81
4 0.84
5 0.82
6 0.83
7 0.85
8 0.81
9 0.83
10 0.78
11 0.78
12 0.78
13 0.81
14 0.82
15 0.83
16 0.85
17 0.77
18 0.78
19 0.76
20 0.76
21 0.69
22 0.65
23 0.66
24 0.65
25 0.66
26 0.61
27 0.6
28 0.5
29 0.45
30 0.4
31 0.31
32 0.25
33 0.22
34 0.24
35 0.19
36 0.21
37 0.22
38 0.21
39 0.19
40 0.16
41 0.17
42 0.14
43 0.11
44 0.09
45 0.08
46 0.08
47 0.08
48 0.08
49 0.07
50 0.08
51 0.09
52 0.14
53 0.19
54 0.2
55 0.23
56 0.26
57 0.29
58 0.34
59 0.42
60 0.48
61 0.54
62 0.59
63 0.67
64 0.72
65 0.76
66 0.77