Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SCN4

Protein Details
Accession G0SCN4    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-114LWGRRAGKDKKGRQRKLPALVBasic
NLS Segment(s)
PositionSequence
96-109GRRAGKDKKGRQRK
Subcellular Location(s) nucl 15, cyto_nucl 12.833, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR006993  Glut_rich_SH3-bd  
IPR036249  Thioredoxin-like_sf  
KEGG cthr:CTHT_0057850  -  
Pfam View protein in Pfam  
PF04908  SH3BGR  
Amino Acid Sequences MSEASSTPNQDAAASGSASTTTAVASSTSTNNSTGLPPKPTTYSTDPALYIYTSLTAGSSHIVTATSRLETILRANRIPFKAIDLATDEKARMLWGRRAGKDKKGRQRKLPALVQMGMVLGDIVEIEEWNEYGELKQHVTFYYDEFTQPSLQQHQEWLKKQEQLKQQRQQQQQQAKPAAPPAAPPAPPPLPEKTSATTTTTSKPTPVATNPAAAAAAAALPIRSIAEEAAAKAKQVQLQALREKVHGKAGAKAGTSAVTTEKTSEVKAISEGTEEKAKLQAGKESEETKKEEEKEEEKKEDESID
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.12
5 0.12
6 0.11
7 0.08
8 0.06
9 0.06
10 0.06
11 0.06
12 0.08
13 0.1
14 0.12
15 0.14
16 0.16
17 0.17
18 0.17
19 0.18
20 0.2
21 0.24
22 0.26
23 0.29
24 0.29
25 0.31
26 0.34
27 0.34
28 0.37
29 0.38
30 0.38
31 0.36
32 0.37
33 0.34
34 0.32
35 0.31
36 0.24
37 0.18
38 0.14
39 0.11
40 0.09
41 0.08
42 0.08
43 0.07
44 0.07
45 0.08
46 0.08
47 0.07
48 0.07
49 0.07
50 0.07
51 0.09
52 0.11
53 0.1
54 0.1
55 0.1
56 0.11
57 0.11
58 0.18
59 0.22
60 0.24
61 0.24
62 0.27
63 0.34
64 0.34
65 0.36
66 0.29
67 0.26
68 0.28
69 0.27
70 0.25
71 0.22
72 0.24
73 0.23
74 0.24
75 0.2
76 0.15
77 0.15
78 0.15
79 0.14
80 0.15
81 0.19
82 0.26
83 0.33
84 0.37
85 0.45
86 0.49
87 0.55
88 0.61
89 0.66
90 0.68
91 0.72
92 0.75
93 0.76
94 0.82
95 0.81
96 0.79
97 0.75
98 0.7
99 0.63
100 0.57
101 0.48
102 0.38
103 0.29
104 0.2
105 0.15
106 0.09
107 0.04
108 0.03
109 0.02
110 0.02
111 0.02
112 0.02
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.07
121 0.08
122 0.09
123 0.1
124 0.1
125 0.1
126 0.12
127 0.13
128 0.11
129 0.12
130 0.11
131 0.11
132 0.11
133 0.12
134 0.11
135 0.11
136 0.12
137 0.14
138 0.14
139 0.14
140 0.18
141 0.23
142 0.28
143 0.31
144 0.34
145 0.34
146 0.38
147 0.41
148 0.44
149 0.46
150 0.51
151 0.57
152 0.6
153 0.65
154 0.7
155 0.74
156 0.75
157 0.74
158 0.73
159 0.68
160 0.68
161 0.63
162 0.54
163 0.48
164 0.42
165 0.36
166 0.26
167 0.23
168 0.2
169 0.21
170 0.2
171 0.2
172 0.23
173 0.22
174 0.24
175 0.26
176 0.26
177 0.24
178 0.26
179 0.29
180 0.25
181 0.27
182 0.27
183 0.27
184 0.25
185 0.25
186 0.27
187 0.27
188 0.25
189 0.23
190 0.22
191 0.21
192 0.23
193 0.22
194 0.25
195 0.23
196 0.24
197 0.23
198 0.22
199 0.2
200 0.16
201 0.13
202 0.07
203 0.05
204 0.04
205 0.04
206 0.03
207 0.03
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.06
214 0.07
215 0.08
216 0.13
217 0.13
218 0.13
219 0.14
220 0.16
221 0.17
222 0.18
223 0.22
224 0.24
225 0.3
226 0.36
227 0.38
228 0.37
229 0.37
230 0.38
231 0.34
232 0.35
233 0.33
234 0.28
235 0.3
236 0.34
237 0.35
238 0.33
239 0.32
240 0.26
241 0.23
242 0.22
243 0.17
244 0.14
245 0.13
246 0.13
247 0.14
248 0.16
249 0.16
250 0.16
251 0.18
252 0.17
253 0.16
254 0.17
255 0.17
256 0.15
257 0.16
258 0.17
259 0.18
260 0.22
261 0.21
262 0.21
263 0.23
264 0.24
265 0.25
266 0.25
267 0.28
268 0.26
269 0.3
270 0.33
271 0.36
272 0.39
273 0.4
274 0.43
275 0.42
276 0.46
277 0.45
278 0.47
279 0.49
280 0.52
281 0.57
282 0.62
283 0.62
284 0.57
285 0.55