Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

P0CU28

Protein Details
Accession P0CU28    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
99-128LAAKVEKASRQQRKQRKNRLKTLRGTAKVKHydrophilic
NLS Segment(s)
PositionSequence
97-136AGLAAKVEKASRQQRKQRKNRLKTLRGTAKVKGAKAKKEK
Subcellular Location(s) nucl 12, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0008168  F:methyltransferase activity  
GO:0003735  F:structural constituent of ribosome  
GO:0032259  P:methylation  
GO:0006412  P:translation  
KEGG cthr:CTHT_0041970  -  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADTDSPVTLRTRKFIRNPLLSRKQMVVDILHPGRPNISKDELREKLATMYKAQKDQVSVFGLRTQYGGGKTTGFALIYDSPEALKKFEPRYRLVRAGLAAKVEKASRQQRKQRKNRLKTLRGTAKVKGAKAKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.55
3 0.61
4 0.66
5 0.71
6 0.75
7 0.78
8 0.73
9 0.68
10 0.61
11 0.53
12 0.45
13 0.4
14 0.31
15 0.23
16 0.27
17 0.25
18 0.25
19 0.24
20 0.22
21 0.24
22 0.24
23 0.25
24 0.22
25 0.27
26 0.27
27 0.31
28 0.4
29 0.39
30 0.4
31 0.38
32 0.34
33 0.33
34 0.34
35 0.31
36 0.25
37 0.31
38 0.3
39 0.32
40 0.33
41 0.29
42 0.27
43 0.27
44 0.27
45 0.22
46 0.2
47 0.17
48 0.19
49 0.18
50 0.16
51 0.15
52 0.11
53 0.1
54 0.1
55 0.11
56 0.09
57 0.09
58 0.09
59 0.09
60 0.1
61 0.08
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.09
68 0.08
69 0.11
70 0.11
71 0.11
72 0.12
73 0.16
74 0.23
75 0.26
76 0.3
77 0.33
78 0.39
79 0.44
80 0.46
81 0.43
82 0.38
83 0.37
84 0.36
85 0.33
86 0.29
87 0.23
88 0.19
89 0.19
90 0.17
91 0.17
92 0.22
93 0.32
94 0.39
95 0.49
96 0.59
97 0.68
98 0.78
99 0.87
100 0.9
101 0.91
102 0.91
103 0.92
104 0.93
105 0.91
106 0.89
107 0.89
108 0.88
109 0.84
110 0.78
111 0.71
112 0.7
113 0.66
114 0.62
115 0.61
116 0.58