Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G0SDK3

Protein Details
Accession G0SDK3    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-56PGQPTTDQKLKRKRENRYKNAPPAVLHydrophilic
NLS Segment(s)
PositionSequence
40-74LKRKRENRYKNAPPAVLSRRRAQNRASQRAYRERK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
KEGG cthr:CTHT_0052090  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences METYGDAVDNSFYYGNYPSRNPTPDTEENEPGQPTTDQKLKRKRENRYKNAPPAVLSRRRAQNRASQRAYRERKEQRIRDLEHMLNEARQRNDVLSQAYAALHAEYMALKNSQLAVGGDAGAVPGGYAQQQEQVELAYGTAISGAIDFGLVAITNPLGKPEMFGYDPNGLSGGYPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.19
4 0.22
5 0.26
6 0.32
7 0.35
8 0.36
9 0.37
10 0.42
11 0.46
12 0.5
13 0.5
14 0.48
15 0.47
16 0.46
17 0.43
18 0.34
19 0.29
20 0.23
21 0.2
22 0.21
23 0.26
24 0.3
25 0.39
26 0.49
27 0.56
28 0.66
29 0.72
30 0.78
31 0.83
32 0.87
33 0.88
34 0.89
35 0.89
36 0.88
37 0.85
38 0.75
39 0.66
40 0.62
41 0.61
42 0.58
43 0.51
44 0.48
45 0.51
46 0.55
47 0.56
48 0.51
49 0.52
50 0.55
51 0.61
52 0.6
53 0.55
54 0.56
55 0.63
56 0.67
57 0.62
58 0.61
59 0.6
60 0.65
61 0.71
62 0.7
63 0.68
64 0.69
65 0.68
66 0.63
67 0.6
68 0.51
69 0.42
70 0.39
71 0.3
72 0.24
73 0.24
74 0.22
75 0.17
76 0.16
77 0.16
78 0.14
79 0.16
80 0.15
81 0.13
82 0.11
83 0.1
84 0.1
85 0.09
86 0.09
87 0.08
88 0.06
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.06
98 0.06
99 0.06
100 0.07
101 0.06
102 0.06
103 0.06
104 0.06
105 0.06
106 0.05
107 0.05
108 0.04
109 0.04
110 0.03
111 0.02
112 0.03
113 0.03
114 0.04
115 0.04
116 0.1
117 0.1
118 0.11
119 0.11
120 0.11
121 0.11
122 0.11
123 0.1
124 0.05
125 0.05
126 0.04
127 0.04
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.04
140 0.04
141 0.06
142 0.06
143 0.07
144 0.09
145 0.09
146 0.11
147 0.12
148 0.17
149 0.17
150 0.18
151 0.22
152 0.26
153 0.26
154 0.25
155 0.23
156 0.18