Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UF02

Protein Details
Accession Q0UF02    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
158-189FGPHSHKKPYVESKGRKFERARGRRRSRGFKVBasic
NLS Segment(s)
PositionSequence
162-189SHKKPYVESKGRKFERARGRRRSRGFKV
Subcellular Location(s) nucl 12, cyto 8, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036227  L18e/L15P_sf  
IPR021132  Ribosomal_L18/L18-A/B/e_CS  
IPR000039  Ribosomal_L18e  
IPR021131  Ribosomal_L18e/L15P  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_09662  -  
Pfam View protein in Pfam  
PF17135  Ribosomal_L18  
PROSITE View protein in PROSITE  
PS01106  RIBOSOMAL_L18E  
Amino Acid Sequences MGIDLDKHHVRDGHRKVPKSTNPYVKLLVRLYKFLARRTDAPFNKVVLRRLMMSKINRPPVSLSKIVATAANKHSSKAHDGKTIVIVGTVTDDNRLLELPKLSIAAMRFTASARARILKAGGETLTIDEVATRYPTGANTLLLRGPKNSRESVKHFGFGPHSHKKPYVESKGRKFERARGRRRSRGFKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.61
3 0.64
4 0.7
5 0.74
6 0.72
7 0.72
8 0.72
9 0.68
10 0.68
11 0.67
12 0.59
13 0.56
14 0.52
15 0.5
16 0.41
17 0.39
18 0.38
19 0.39
20 0.4
21 0.4
22 0.42
23 0.38
24 0.41
25 0.46
26 0.53
27 0.49
28 0.5
29 0.47
30 0.42
31 0.46
32 0.44
33 0.41
34 0.34
35 0.33
36 0.31
37 0.31
38 0.33
39 0.33
40 0.34
41 0.4
42 0.43
43 0.51
44 0.48
45 0.47
46 0.47
47 0.47
48 0.47
49 0.4
50 0.34
51 0.26
52 0.26
53 0.26
54 0.23
55 0.18
56 0.17
57 0.19
58 0.25
59 0.24
60 0.24
61 0.26
62 0.26
63 0.31
64 0.32
65 0.32
66 0.3
67 0.31
68 0.31
69 0.3
70 0.28
71 0.21
72 0.15
73 0.12
74 0.07
75 0.08
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.06
83 0.05
84 0.06
85 0.06
86 0.06
87 0.06
88 0.07
89 0.07
90 0.08
91 0.08
92 0.08
93 0.09
94 0.09
95 0.09
96 0.09
97 0.15
98 0.14
99 0.16
100 0.16
101 0.18
102 0.17
103 0.18
104 0.18
105 0.14
106 0.14
107 0.12
108 0.11
109 0.1
110 0.09
111 0.09
112 0.09
113 0.08
114 0.07
115 0.05
116 0.06
117 0.06
118 0.06
119 0.06
120 0.06
121 0.06
122 0.07
123 0.1
124 0.11
125 0.12
126 0.12
127 0.14
128 0.16
129 0.17
130 0.18
131 0.18
132 0.22
133 0.26
134 0.3
135 0.34
136 0.37
137 0.42
138 0.48
139 0.53
140 0.52
141 0.48
142 0.44
143 0.43
144 0.42
145 0.41
146 0.42
147 0.43
148 0.44
149 0.46
150 0.5
151 0.5
152 0.53
153 0.58
154 0.61
155 0.62
156 0.68
157 0.74
158 0.8
159 0.81
160 0.8
161 0.74
162 0.72
163 0.73
164 0.74
165 0.74
166 0.75
167 0.81
168 0.83
169 0.89