Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PND8

Protein Details
Accession F8PND8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
8-27KYIYIHDTRHRNKQRNQIYHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 6, cyto 5, pero 2
Family & Domain DBs
Amino Acid Sequences MLWQCREKYIYIHDTRHRNKQRNQIYHGFDYRHNASIIERLSDQVTKPSMMDELFSLIRRRGDFLGRADLTKLIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.71
4 0.73
5 0.72
6 0.74
7 0.77
8 0.8
9 0.78
10 0.79
11 0.76
12 0.72
13 0.68
14 0.64
15 0.55
16 0.46
17 0.43
18 0.38
19 0.32
20 0.27
21 0.21
22 0.18
23 0.2
24 0.19
25 0.15
26 0.13
27 0.12
28 0.12
29 0.13
30 0.13
31 0.12
32 0.13
33 0.12
34 0.12
35 0.12
36 0.12
37 0.11
38 0.12
39 0.08
40 0.11
41 0.11
42 0.13
43 0.15
44 0.16
45 0.19
46 0.19
47 0.22
48 0.22
49 0.26
50 0.29
51 0.31
52 0.38
53 0.36
54 0.36
55 0.34