Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PX23

Protein Details
Accession F8PX23    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
59-78PYMVIPYRCKHKKKVKNRNGHydrophilic
NLS Segment(s)
PositionSequence
70-76KKKVKNR
Subcellular Location(s) nucl 20, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MTKQCVDTPKDDMWCCSVERQKSGHKTIKGAGNMSQVARPKVMQLAFNNKRNLDLKDLPYMVIPYRCKHKKKVKNRNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.31
3 0.32
4 0.33
5 0.31
6 0.34
7 0.36
8 0.42
9 0.48
10 0.54
11 0.55
12 0.51
13 0.5
14 0.51
15 0.53
16 0.46
17 0.4
18 0.34
19 0.3
20 0.29
21 0.26
22 0.24
23 0.2
24 0.19
25 0.18
26 0.15
27 0.13
28 0.15
29 0.16
30 0.17
31 0.18
32 0.28
33 0.34
34 0.4
35 0.43
36 0.39
37 0.42
38 0.41
39 0.4
40 0.37
41 0.36
42 0.33
43 0.36
44 0.37
45 0.33
46 0.31
47 0.3
48 0.26
49 0.26
50 0.26
51 0.24
52 0.34
53 0.43
54 0.48
55 0.57
56 0.65
57 0.69
58 0.78