Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0TYI8

Protein Details
Accession Q0TYI8    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-63PCPSIRCATTKAPKKKNKKGRNTFVQYDLKKHydrophilic
NLS Segment(s)
PositionSequence
44-53APKKKNKKGR
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR028364  Ribosomal_L1/biogenesis  
IPR016095  Ribosomal_L1_3-a/b-sand  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG pno:SNOG_15530  -  
Pfam View protein in Pfam  
PF00687  Ribosomal_L1  
CDD cd00403  Ribosomal_L1  
Amino Acid Sequences MANPRSLVSPLSRLATFSVGASRPVVARVSALPCPSIRCATTKAPKKKNKKGRNTFVQYDLKKTEQFPLVDAMQYIRAFEVGRNPSSSKYELHVRLRSLKNGPTVRNRLRLPHPVKTDIRICVIAAPDSKAAAEARAEGAVLVGEDDIFAQIKEGIIEFDRCLCHIDSLQKLNKAALGRQLGPKGLMPSAKTGTVVTNVGASVRNMVGASEYRERMGVVRMAVGQLGFTPEEMQRNVKAFMDAVKKDIAQLSLKITKEIHEVVLSSTNAPGFTLNGDFRGANSIATKELSGPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.22
4 0.18
5 0.21
6 0.18
7 0.19
8 0.19
9 0.18
10 0.17
11 0.18
12 0.18
13 0.13
14 0.14
15 0.16
16 0.2
17 0.22
18 0.22
19 0.22
20 0.22
21 0.26
22 0.27
23 0.27
24 0.24
25 0.24
26 0.29
27 0.36
28 0.45
29 0.52
30 0.6
31 0.67
32 0.75
33 0.83
34 0.88
35 0.9
36 0.91
37 0.92
38 0.92
39 0.92
40 0.93
41 0.91
42 0.84
43 0.82
44 0.8
45 0.71
46 0.66
47 0.59
48 0.51
49 0.46
50 0.43
51 0.4
52 0.36
53 0.35
54 0.29
55 0.29
56 0.27
57 0.25
58 0.23
59 0.18
60 0.17
61 0.16
62 0.15
63 0.11
64 0.11
65 0.11
66 0.12
67 0.19
68 0.19
69 0.2
70 0.23
71 0.24
72 0.25
73 0.29
74 0.3
75 0.23
76 0.22
77 0.29
78 0.33
79 0.39
80 0.41
81 0.4
82 0.47
83 0.48
84 0.5
85 0.46
86 0.43
87 0.44
88 0.46
89 0.48
90 0.47
91 0.54
92 0.54
93 0.58
94 0.55
95 0.53
96 0.53
97 0.59
98 0.56
99 0.54
100 0.53
101 0.53
102 0.53
103 0.51
104 0.49
105 0.41
106 0.37
107 0.3
108 0.25
109 0.2
110 0.19
111 0.17
112 0.13
113 0.13
114 0.11
115 0.11
116 0.1
117 0.09
118 0.09
119 0.08
120 0.07
121 0.06
122 0.06
123 0.06
124 0.06
125 0.05
126 0.05
127 0.04
128 0.04
129 0.03
130 0.02
131 0.02
132 0.02
133 0.02
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.04
141 0.04
142 0.04
143 0.05
144 0.06
145 0.06
146 0.08
147 0.08
148 0.09
149 0.11
150 0.1
151 0.11
152 0.12
153 0.16
154 0.18
155 0.24
156 0.27
157 0.27
158 0.27
159 0.26
160 0.27
161 0.23
162 0.21
163 0.21
164 0.21
165 0.21
166 0.24
167 0.25
168 0.23
169 0.23
170 0.23
171 0.19
172 0.17
173 0.16
174 0.14
175 0.17
176 0.18
177 0.17
178 0.16
179 0.15
180 0.15
181 0.15
182 0.14
183 0.11
184 0.1
185 0.09
186 0.09
187 0.1
188 0.08
189 0.08
190 0.08
191 0.08
192 0.07
193 0.07
194 0.08
195 0.09
196 0.13
197 0.16
198 0.16
199 0.16
200 0.16
201 0.17
202 0.16
203 0.18
204 0.16
205 0.12
206 0.13
207 0.13
208 0.13
209 0.13
210 0.12
211 0.09
212 0.07
213 0.08
214 0.07
215 0.07
216 0.09
217 0.1
218 0.14
219 0.16
220 0.18
221 0.19
222 0.22
223 0.23
224 0.22
225 0.21
226 0.18
227 0.23
228 0.28
229 0.26
230 0.25
231 0.26
232 0.25
233 0.26
234 0.28
235 0.24
236 0.18
237 0.2
238 0.24
239 0.29
240 0.29
241 0.3
242 0.28
243 0.27
244 0.29
245 0.29
246 0.24
247 0.19
248 0.19
249 0.19
250 0.24
251 0.23
252 0.19
253 0.19
254 0.17
255 0.16
256 0.16
257 0.14
258 0.09
259 0.11
260 0.15
261 0.14
262 0.15
263 0.17
264 0.16
265 0.16
266 0.21
267 0.19
268 0.16
269 0.18
270 0.18
271 0.18
272 0.19
273 0.19