Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PQN2

Protein Details
Accession F8PQN2    Localization Confidence Low Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
68-90CPILHNSKVSCRRQRDPRELLNEHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 15.5, nucl 13.5, cyto 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MEVELQLLSNFQRIAGVHTTLHSALQDAQLRQRHQRDYQPAEGLGRKKGGHGVQRGKEGSTHGIYRKCPILHNSKVSCRRQRDPRELLNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.19
4 0.17
5 0.17
6 0.2
7 0.18
8 0.18
9 0.13
10 0.11
11 0.11
12 0.15
13 0.19
14 0.17
15 0.23
16 0.28
17 0.31
18 0.37
19 0.41
20 0.41
21 0.42
22 0.49
23 0.51
24 0.52
25 0.53
26 0.48
27 0.43
28 0.4
29 0.39
30 0.33
31 0.26
32 0.22
33 0.18
34 0.16
35 0.2
36 0.22
37 0.25
38 0.31
39 0.38
40 0.39
41 0.44
42 0.44
43 0.4
44 0.37
45 0.33
46 0.29
47 0.24
48 0.24
49 0.23
50 0.27
51 0.28
52 0.3
53 0.34
54 0.31
55 0.32
56 0.34
57 0.39
58 0.42
59 0.51
60 0.53
61 0.57
62 0.66
63 0.71
64 0.75
65 0.74
66 0.76
67 0.77
68 0.82
69 0.83
70 0.82