Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8Q7P3

Protein Details
Accession F8Q7P3    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
4-25GYSYRDPKPRNWRSTRPFSLNPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 10.5, cyto 6, pero 4, mito 3
Family & Domain DBs
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MEEGYSYRDPKPRNWRSTRPFSLNPSFKPPIPLSDTLRTLIYRQYMTDPKTNGVRALDTQCHLSIKLVDAILRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.75
3 0.77
4 0.85
5 0.84
6 0.8
7 0.75
8 0.72
9 0.73
10 0.68
11 0.62
12 0.59
13 0.54
14 0.46
15 0.47
16 0.4
17 0.34
18 0.33
19 0.34
20 0.31
21 0.33
22 0.34
23 0.29
24 0.3
25 0.25
26 0.21
27 0.2
28 0.17
29 0.13
30 0.13
31 0.17
32 0.21
33 0.24
34 0.28
35 0.27
36 0.27
37 0.31
38 0.31
39 0.28
40 0.24
41 0.24
42 0.22
43 0.26
44 0.27
45 0.24
46 0.26
47 0.25
48 0.25
49 0.23
50 0.22
51 0.18
52 0.17
53 0.2
54 0.18
55 0.19