Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QDP3

Protein Details
Accession F8QDP3   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
69-89RLKVEFRKRFNEKRVERYRIVBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 3, plas 3
Family & Domain DBs
Amino Acid Sequences MLHFNSTFLTLPDDQDGRPVDIPVFRLVRHDGQGDIRKVADEDDPKMTVQTRTVSMGQWMFDVRSFYVRLKVEFRKRFNEKRVERYRIVEME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.23
3 0.25
4 0.22
5 0.22
6 0.21
7 0.18
8 0.19
9 0.21
10 0.2
11 0.2
12 0.17
13 0.19
14 0.22
15 0.23
16 0.24
17 0.23
18 0.19
19 0.24
20 0.31
21 0.29
22 0.27
23 0.24
24 0.22
25 0.21
26 0.21
27 0.18
28 0.13
29 0.14
30 0.16
31 0.16
32 0.16
33 0.16
34 0.16
35 0.13
36 0.13
37 0.12
38 0.11
39 0.14
40 0.14
41 0.14
42 0.15
43 0.16
44 0.14
45 0.13
46 0.12
47 0.1
48 0.11
49 0.12
50 0.1
51 0.12
52 0.14
53 0.14
54 0.2
55 0.21
56 0.23
57 0.28
58 0.37
59 0.45
60 0.52
61 0.56
62 0.6
63 0.68
64 0.74
65 0.77
66 0.79
67 0.76
68 0.78
69 0.83
70 0.81
71 0.76
72 0.71