Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QC01

Protein Details
Accession F8QC01   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-48LQQPPSEKKVKPLKTRRPKISSEYPRTWHydrophilic
NLS Segment(s)
PositionSequence
28-39KKVKPLKTRRPK
Subcellular Location(s) nucl 15, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR008914  PEBP  
IPR036610  PEBP-like_sf  
IPR035810  PEBP_euk  
Pfam View protein in Pfam  
PF01161  PBP  
CDD cd00866  PEBP_euk  
Amino Acid Sequences MFAVRRFRPKSSSFARGNATLQQPPSEKKVKPLKTRRPKISSEYPRTWNRPLAFGVLPAFDEALKVIKEDSVLLKKEVESLKDALKQVEEAPEKDEDLVKVMKEKLSILDVQSEVNFPEVRWKCTNGLADMSKAVDRHIVEKKWRKEGTLDLLMERIHQMNVVPDVLPSLHPSFDLRVVFPEAPSTNTTPSSKSGTKYAQVEPGIYLTAEQTLSAPTLYATVFHTDERLYTLMMVDPDVPDVSNQTYQTYLHWLQPNVRLSATTSSLANLDQHTPYVSPHPQRGTPYHRYVMLLLPQSSEISAPKLSMDERLGFSVRAFMDKYGLDGSVGGGAHMWREVWSEGVSSVYQGTLKCEEPRFGRPPKRDPYADIRQKRRYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.54
4 0.53
5 0.51
6 0.48
7 0.43
8 0.4
9 0.4
10 0.4
11 0.4
12 0.46
13 0.47
14 0.43
15 0.48
16 0.57
17 0.61
18 0.67
19 0.75
20 0.79
21 0.82
22 0.91
23 0.92
24 0.89
25 0.85
26 0.83
27 0.83
28 0.83
29 0.81
30 0.78
31 0.75
32 0.77
33 0.76
34 0.73
35 0.69
36 0.6
37 0.55
38 0.49
39 0.46
40 0.37
41 0.33
42 0.3
43 0.23
44 0.21
45 0.17
46 0.16
47 0.11
48 0.1
49 0.08
50 0.1
51 0.09
52 0.09
53 0.09
54 0.09
55 0.1
56 0.12
57 0.17
58 0.21
59 0.23
60 0.24
61 0.25
62 0.24
63 0.31
64 0.31
65 0.27
66 0.24
67 0.25
68 0.28
69 0.32
70 0.33
71 0.27
72 0.26
73 0.25
74 0.23
75 0.29
76 0.27
77 0.22
78 0.23
79 0.23
80 0.23
81 0.23
82 0.23
83 0.15
84 0.15
85 0.16
86 0.14
87 0.17
88 0.18
89 0.19
90 0.18
91 0.18
92 0.16
93 0.18
94 0.19
95 0.16
96 0.18
97 0.17
98 0.17
99 0.16
100 0.15
101 0.13
102 0.13
103 0.12
104 0.09
105 0.19
106 0.2
107 0.25
108 0.27
109 0.3
110 0.29
111 0.34
112 0.37
113 0.28
114 0.31
115 0.27
116 0.25
117 0.23
118 0.22
119 0.18
120 0.15
121 0.14
122 0.13
123 0.12
124 0.17
125 0.23
126 0.26
127 0.34
128 0.43
129 0.48
130 0.54
131 0.54
132 0.5
133 0.46
134 0.48
135 0.46
136 0.44
137 0.39
138 0.3
139 0.3
140 0.29
141 0.26
142 0.22
143 0.15
144 0.08
145 0.07
146 0.07
147 0.08
148 0.09
149 0.09
150 0.08
151 0.07
152 0.08
153 0.08
154 0.08
155 0.09
156 0.09
157 0.08
158 0.09
159 0.1
160 0.1
161 0.13
162 0.14
163 0.11
164 0.12
165 0.15
166 0.15
167 0.14
168 0.15
169 0.12
170 0.13
171 0.15
172 0.15
173 0.13
174 0.15
175 0.16
176 0.15
177 0.17
178 0.2
179 0.21
180 0.2
181 0.23
182 0.24
183 0.26
184 0.28
185 0.28
186 0.28
187 0.26
188 0.26
189 0.21
190 0.2
191 0.16
192 0.12
193 0.11
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.05
200 0.06
201 0.05
202 0.05
203 0.04
204 0.05
205 0.05
206 0.06
207 0.06
208 0.09
209 0.1
210 0.1
211 0.11
212 0.09
213 0.1
214 0.11
215 0.11
216 0.08
217 0.08
218 0.08
219 0.08
220 0.09
221 0.09
222 0.07
223 0.07
224 0.07
225 0.07
226 0.07
227 0.06
228 0.07
229 0.09
230 0.11
231 0.11
232 0.11
233 0.12
234 0.12
235 0.13
236 0.19
237 0.18
238 0.21
239 0.25
240 0.26
241 0.29
242 0.35
243 0.38
244 0.32
245 0.31
246 0.25
247 0.23
248 0.25
249 0.24
250 0.18
251 0.15
252 0.14
253 0.14
254 0.14
255 0.14
256 0.12
257 0.12
258 0.12
259 0.12
260 0.12
261 0.12
262 0.13
263 0.18
264 0.23
265 0.24
266 0.3
267 0.33
268 0.35
269 0.39
270 0.45
271 0.48
272 0.49
273 0.52
274 0.49
275 0.47
276 0.45
277 0.42
278 0.39
279 0.37
280 0.33
281 0.27
282 0.25
283 0.24
284 0.23
285 0.21
286 0.18
287 0.13
288 0.12
289 0.12
290 0.11
291 0.11
292 0.12
293 0.12
294 0.15
295 0.18
296 0.18
297 0.19
298 0.22
299 0.23
300 0.21
301 0.21
302 0.22
303 0.2
304 0.19
305 0.18
306 0.16
307 0.18
308 0.17
309 0.19
310 0.15
311 0.15
312 0.12
313 0.11
314 0.12
315 0.12
316 0.11
317 0.09
318 0.09
319 0.09
320 0.09
321 0.09
322 0.09
323 0.06
324 0.09
325 0.1
326 0.11
327 0.12
328 0.12
329 0.12
330 0.14
331 0.13
332 0.11
333 0.11
334 0.11
335 0.12
336 0.11
337 0.16
338 0.17
339 0.2
340 0.26
341 0.29
342 0.33
343 0.36
344 0.45
345 0.48
346 0.55
347 0.62
348 0.65
349 0.71
350 0.75
351 0.78
352 0.73
353 0.72
354 0.71
355 0.72
356 0.74
357 0.75
358 0.75