Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PUY6

Protein Details
Accession F8PUY6    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-93ASTGTASRPSRKRKTPPAVSATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MLAHNYSQSQQQQQPSSSSAQPQQPSSGGQQQSQDQLTQHASTMQTMRLRDDPPPINNPSNNSAMPANAGTASTGTASRPSRKRKTPPAVSATDGPLPPPPPHQQQHPGIPPSFQHILPPPHALAPPPGMHPHHPGPIPHTYQYAPGPEYPHPPPTQEQGHQHPGSVSPTGGAGGGRTLSQSKRAEQNRKAQRAFRERRDQHVKALESRSQLLDAALASADEANRRWEECRALVDQLRIENAALRGALSQTQQMGAGQAQAQLLAGNPTSNPTSHTVGQQQQQQESPGEGGENKDSVAKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.48
3 0.47
4 0.42
5 0.42
6 0.41
7 0.43
8 0.43
9 0.42
10 0.42
11 0.39
12 0.39
13 0.38
14 0.4
15 0.35
16 0.35
17 0.36
18 0.36
19 0.4
20 0.38
21 0.35
22 0.26
23 0.28
24 0.29
25 0.26
26 0.23
27 0.21
28 0.2
29 0.21
30 0.22
31 0.23
32 0.24
33 0.24
34 0.27
35 0.29
36 0.3
37 0.3
38 0.36
39 0.38
40 0.38
41 0.44
42 0.46
43 0.47
44 0.48
45 0.49
46 0.44
47 0.43
48 0.38
49 0.34
50 0.28
51 0.22
52 0.22
53 0.18
54 0.14
55 0.1
56 0.1
57 0.08
58 0.08
59 0.08
60 0.07
61 0.07
62 0.07
63 0.13
64 0.16
65 0.24
66 0.32
67 0.42
68 0.5
69 0.59
70 0.68
71 0.73
72 0.81
73 0.82
74 0.83
75 0.8
76 0.74
77 0.67
78 0.6
79 0.52
80 0.44
81 0.34
82 0.26
83 0.22
84 0.21
85 0.19
86 0.22
87 0.24
88 0.29
89 0.31
90 0.36
91 0.41
92 0.44
93 0.51
94 0.53
95 0.51
96 0.44
97 0.42
98 0.37
99 0.34
100 0.32
101 0.24
102 0.2
103 0.22
104 0.25
105 0.25
106 0.27
107 0.22
108 0.22
109 0.22
110 0.2
111 0.16
112 0.16
113 0.15
114 0.15
115 0.17
116 0.17
117 0.19
118 0.23
119 0.24
120 0.25
121 0.25
122 0.24
123 0.25
124 0.29
125 0.29
126 0.25
127 0.25
128 0.21
129 0.22
130 0.24
131 0.21
132 0.17
133 0.16
134 0.18
135 0.17
136 0.21
137 0.2
138 0.23
139 0.22
140 0.22
141 0.23
142 0.24
143 0.27
144 0.27
145 0.3
146 0.31
147 0.39
148 0.37
149 0.36
150 0.31
151 0.28
152 0.26
153 0.22
154 0.16
155 0.08
156 0.08
157 0.08
158 0.08
159 0.06
160 0.04
161 0.04
162 0.05
163 0.04
164 0.05
165 0.07
166 0.08
167 0.15
168 0.17
169 0.2
170 0.28
171 0.37
172 0.46
173 0.5
174 0.59
175 0.62
176 0.69
177 0.69
178 0.66
179 0.67
180 0.68
181 0.7
182 0.69
183 0.7
184 0.64
185 0.71
186 0.75
187 0.68
188 0.63
189 0.63
190 0.56
191 0.51
192 0.54
193 0.48
194 0.4
195 0.4
196 0.34
197 0.27
198 0.24
199 0.18
200 0.14
201 0.1
202 0.08
203 0.06
204 0.05
205 0.05
206 0.05
207 0.06
208 0.06
209 0.07
210 0.1
211 0.12
212 0.13
213 0.15
214 0.17
215 0.21
216 0.22
217 0.25
218 0.24
219 0.27
220 0.29
221 0.3
222 0.29
223 0.26
224 0.25
225 0.22
226 0.19
227 0.18
228 0.16
229 0.14
230 0.12
231 0.11
232 0.11
233 0.11
234 0.13
235 0.11
236 0.12
237 0.12
238 0.12
239 0.12
240 0.12
241 0.12
242 0.11
243 0.11
244 0.1
245 0.12
246 0.11
247 0.11
248 0.11
249 0.09
250 0.09
251 0.09
252 0.09
253 0.08
254 0.08
255 0.11
256 0.12
257 0.12
258 0.15
259 0.17
260 0.22
261 0.24
262 0.28
263 0.33
264 0.38
265 0.43
266 0.47
267 0.47
268 0.46
269 0.46
270 0.44
271 0.38
272 0.34
273 0.29
274 0.23
275 0.21
276 0.18
277 0.19
278 0.19
279 0.18
280 0.16