Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8Q344

Protein Details
Accession F8Q344    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
51-70EDEAKRWKEKDRKALKEHESBasic
NLS Segment(s)
PositionSequence
56-66RWKEKDRKALK
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MPPTSCAPELFDPLMGWHTYEQTLANPASDRQAFSGKSLWRLLQMGWLCREDEAKRWKEKDRKALKEHESRSIYPWKALKLPQPKKEDLIEVARKRFLDLNSAHLPESIKVTSTKAPRPVSPSAQDKKRAAEDDPPAPAQAGGGTSPQLKKRKMSTATPNATPIYPPTFVNGRPPKQFPAGNPSDPTPSPRHSTPAARSQTNSGTSLHFKASGVFTRRSGSPSKVNNVNPATPTDFASQARSPCDLAVNSAPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.18
4 0.14
5 0.15
6 0.14
7 0.15
8 0.15
9 0.13
10 0.18
11 0.17
12 0.17
13 0.16
14 0.17
15 0.22
16 0.23
17 0.22
18 0.2
19 0.26
20 0.25
21 0.26
22 0.32
23 0.28
24 0.31
25 0.33
26 0.31
27 0.28
28 0.28
29 0.26
30 0.27
31 0.28
32 0.28
33 0.28
34 0.28
35 0.26
36 0.25
37 0.29
38 0.23
39 0.28
40 0.33
41 0.37
42 0.44
43 0.48
44 0.57
45 0.62
46 0.7
47 0.72
48 0.73
49 0.76
50 0.75
51 0.8
52 0.8
53 0.8
54 0.74
55 0.73
56 0.67
57 0.58
58 0.56
59 0.55
60 0.47
61 0.42
62 0.42
63 0.35
64 0.34
65 0.36
66 0.4
67 0.43
68 0.51
69 0.55
70 0.59
71 0.58
72 0.57
73 0.55
74 0.49
75 0.41
76 0.41
77 0.42
78 0.39
79 0.4
80 0.39
81 0.37
82 0.35
83 0.36
84 0.28
85 0.26
86 0.23
87 0.27
88 0.29
89 0.3
90 0.28
91 0.25
92 0.25
93 0.18
94 0.2
95 0.14
96 0.11
97 0.11
98 0.13
99 0.17
100 0.21
101 0.25
102 0.29
103 0.31
104 0.32
105 0.37
106 0.38
107 0.37
108 0.38
109 0.42
110 0.41
111 0.44
112 0.48
113 0.44
114 0.42
115 0.42
116 0.39
117 0.31
118 0.32
119 0.31
120 0.28
121 0.29
122 0.27
123 0.23
124 0.21
125 0.19
126 0.12
127 0.09
128 0.07
129 0.05
130 0.05
131 0.06
132 0.08
133 0.11
134 0.18
135 0.24
136 0.25
137 0.29
138 0.33
139 0.42
140 0.44
141 0.49
142 0.53
143 0.57
144 0.59
145 0.56
146 0.53
147 0.45
148 0.41
149 0.34
150 0.26
151 0.2
152 0.17
153 0.16
154 0.16
155 0.18
156 0.18
157 0.28
158 0.35
159 0.35
160 0.39
161 0.42
162 0.42
163 0.45
164 0.47
165 0.39
166 0.4
167 0.41
168 0.39
169 0.38
170 0.36
171 0.35
172 0.33
173 0.36
174 0.31
175 0.29
176 0.31
177 0.31
178 0.33
179 0.33
180 0.4
181 0.41
182 0.45
183 0.47
184 0.44
185 0.44
186 0.45
187 0.46
188 0.41
189 0.37
190 0.29
191 0.27
192 0.28
193 0.29
194 0.26
195 0.22
196 0.19
197 0.2
198 0.23
199 0.27
200 0.28
201 0.29
202 0.29
203 0.31
204 0.33
205 0.34
206 0.34
207 0.32
208 0.36
209 0.4
210 0.46
211 0.51
212 0.52
213 0.58
214 0.57
215 0.56
216 0.48
217 0.46
218 0.42
219 0.35
220 0.36
221 0.3
222 0.29
223 0.26
224 0.31
225 0.31
226 0.3
227 0.32
228 0.31
229 0.29
230 0.26
231 0.3
232 0.24
233 0.26