Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QG65

Protein Details
Accession F8QG65   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
250-275LLAVPKMKGKGKKRPPKASSDKHVGPBasic
NLS Segment(s)
PositionSequence
255-281KMKGKGKKRPPKASSDKHVGPKGRLAR
Subcellular Location(s) nucl 14, cyto_nucl 12.333, cyto 8.5, cyto_mito 6.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR016159  Cullin_repeat-like_dom_sf  
Amino Acid Sequences MSKGKGKQVEPPSLMAPLPNPSAGSANPSASLSSLWGYIQPALDHIVRIPSTNPDKAPAVDIAYHMGIHTATYNYFTSQSEAASALPPSPDKAPASGTDLYEQIDKYFAEVARELLLGAPVDDSSLIHYLVPCYKRYSAGAQSVNRLLNYVNRHYVKRAIDEDRGWLTMTDIFDAIAKSIEEGDTREKISKKLKERRTEELKKWGYQDEDAAELLANAEACAEAASSLDRVVPLSSVALRRFRTELVEPLLAVPKMKGKGKKRPPKASSDKHVGPKGRLARAVKELLENPTDNEPERNALATGLAVALRSTGVRADHPLRKKLDKFVESLPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.34
3 0.28
4 0.23
5 0.22
6 0.2
7 0.18
8 0.17
9 0.2
10 0.19
11 0.23
12 0.21
13 0.2
14 0.2
15 0.2
16 0.19
17 0.17
18 0.17
19 0.12
20 0.11
21 0.11
22 0.1
23 0.11
24 0.12
25 0.13
26 0.14
27 0.13
28 0.13
29 0.15
30 0.16
31 0.15
32 0.14
33 0.18
34 0.16
35 0.17
36 0.18
37 0.22
38 0.28
39 0.32
40 0.31
41 0.3
42 0.32
43 0.31
44 0.33
45 0.26
46 0.23
47 0.19
48 0.19
49 0.18
50 0.16
51 0.15
52 0.13
53 0.12
54 0.09
55 0.08
56 0.09
57 0.07
58 0.07
59 0.1
60 0.11
61 0.12
62 0.13
63 0.14
64 0.15
65 0.14
66 0.14
67 0.12
68 0.12
69 0.12
70 0.12
71 0.11
72 0.1
73 0.1
74 0.1
75 0.11
76 0.12
77 0.15
78 0.14
79 0.15
80 0.16
81 0.17
82 0.22
83 0.22
84 0.22
85 0.19
86 0.19
87 0.19
88 0.18
89 0.17
90 0.12
91 0.11
92 0.1
93 0.1
94 0.13
95 0.13
96 0.13
97 0.13
98 0.14
99 0.13
100 0.13
101 0.12
102 0.09
103 0.09
104 0.07
105 0.06
106 0.06
107 0.04
108 0.05
109 0.05
110 0.04
111 0.06
112 0.07
113 0.07
114 0.07
115 0.07
116 0.08
117 0.14
118 0.15
119 0.15
120 0.17
121 0.18
122 0.2
123 0.22
124 0.25
125 0.25
126 0.3
127 0.35
128 0.32
129 0.34
130 0.36
131 0.35
132 0.29
133 0.25
134 0.18
135 0.17
136 0.2
137 0.2
138 0.23
139 0.25
140 0.26
141 0.27
142 0.32
143 0.29
144 0.29
145 0.31
146 0.28
147 0.29
148 0.28
149 0.3
150 0.25
151 0.24
152 0.2
153 0.16
154 0.13
155 0.12
156 0.11
157 0.09
158 0.08
159 0.07
160 0.08
161 0.08
162 0.07
163 0.05
164 0.05
165 0.05
166 0.05
167 0.05
168 0.05
169 0.07
170 0.1
171 0.11
172 0.12
173 0.16
174 0.17
175 0.21
176 0.3
177 0.35
178 0.43
179 0.51
180 0.59
181 0.64
182 0.68
183 0.73
184 0.75
185 0.76
186 0.71
187 0.72
188 0.67
189 0.6
190 0.57
191 0.51
192 0.42
193 0.34
194 0.31
195 0.22
196 0.19
197 0.16
198 0.14
199 0.11
200 0.09
201 0.08
202 0.06
203 0.05
204 0.04
205 0.04
206 0.03
207 0.03
208 0.04
209 0.03
210 0.03
211 0.03
212 0.04
213 0.04
214 0.04
215 0.05
216 0.05
217 0.06
218 0.06
219 0.06
220 0.06
221 0.07
222 0.09
223 0.13
224 0.16
225 0.21
226 0.22
227 0.24
228 0.26
229 0.26
230 0.28
231 0.27
232 0.29
233 0.27
234 0.27
235 0.25
236 0.25
237 0.28
238 0.23
239 0.2
240 0.16
241 0.17
242 0.21
243 0.27
244 0.34
245 0.39
246 0.5
247 0.61
248 0.71
249 0.76
250 0.83
251 0.82
252 0.84
253 0.86
254 0.85
255 0.82
256 0.81
257 0.77
258 0.74
259 0.76
260 0.69
261 0.61
262 0.6
263 0.59
264 0.55
265 0.55
266 0.49
267 0.48
268 0.5
269 0.51
270 0.44
271 0.41
272 0.39
273 0.36
274 0.37
275 0.32
276 0.29
277 0.3
278 0.31
279 0.27
280 0.27
281 0.24
282 0.24
283 0.24
284 0.23
285 0.18
286 0.16
287 0.15
288 0.12
289 0.11
290 0.09
291 0.08
292 0.06
293 0.06
294 0.06
295 0.06
296 0.06
297 0.07
298 0.08
299 0.1
300 0.12
301 0.19
302 0.27
303 0.35
304 0.42
305 0.49
306 0.53
307 0.61
308 0.64
309 0.67
310 0.7
311 0.65
312 0.62