Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PYK3

Protein Details
Accession F8PYK3   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
67-87LYSLRKYRHLRRMYPPNTKPDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR008011  Complex1_LYR_dom  
IPR045296  Complex1_LYR_ETFRF1_LYRM5  
Gene Ontology GO:0022904  P:respiratory electron transport chain  
Pfam View protein in Pfam  
PF05347  Complex1_LYR  
CDD cd20265  Complex1_LYR_ETFRF1_LYRM5  
Amino Acid Sequences MASQPTRLRVLALYKELHRLGRDYDPSYNFHGKLRRMFEKNKDLTDEAEIEKAIKFGEYIKNETLALYSLRKYRHLRRMYPPNTKPDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.37
3 0.37
4 0.37
5 0.31
6 0.28
7 0.27
8 0.3
9 0.34
10 0.31
11 0.35
12 0.34
13 0.35
14 0.39
15 0.4
16 0.34
17 0.33
18 0.36
19 0.34
20 0.38
21 0.42
22 0.43
23 0.44
24 0.49
25 0.52
26 0.57
27 0.56
28 0.51
29 0.48
30 0.41
31 0.37
32 0.33
33 0.27
34 0.18
35 0.15
36 0.13
37 0.11
38 0.1
39 0.1
40 0.08
41 0.06
42 0.05
43 0.08
44 0.15
45 0.18
46 0.21
47 0.22
48 0.23
49 0.23
50 0.23
51 0.21
52 0.15
53 0.14
54 0.13
55 0.15
56 0.18
57 0.2
58 0.27
59 0.34
60 0.43
61 0.51
62 0.57
63 0.62
64 0.68
65 0.78
66 0.8
67 0.84
68 0.8