Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PPT1

Protein Details
Accession F8PPT1    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-35PPPSSGGKAAKKKKWSKGKVKDKAQHAVAHydrophilic
NLS Segment(s)
PositionSequence
4-29AKAPPPSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 15, cyto 8, mito 4, cyto_pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAPPPSSGGKAAKKKKWSKGKVKDKAQHAVAIDKPTFDRVMKEVPTFRFISQSILIERLKVNGSLARVAIRHLEKEGLIKRIVHHSGQLVYTRLTTASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.68
4 0.72
5 0.78
6 0.79
7 0.82
8 0.83
9 0.85
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.81
17 0.71
18 0.63
19 0.53
20 0.48
21 0.4
22 0.37
23 0.3
24 0.24
25 0.22
26 0.2
27 0.21
28 0.16
29 0.15
30 0.13
31 0.17
32 0.18
33 0.2
34 0.23
35 0.22
36 0.25
37 0.25
38 0.23
39 0.21
40 0.2
41 0.21
42 0.18
43 0.18
44 0.15
45 0.17
46 0.17
47 0.16
48 0.15
49 0.14
50 0.14
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.17
61 0.17
62 0.17
63 0.17
64 0.18
65 0.17
66 0.24
67 0.27
68 0.25
69 0.25
70 0.25
71 0.26
72 0.33
73 0.35
74 0.29
75 0.28
76 0.28
77 0.29
78 0.3
79 0.31
80 0.25
81 0.23
82 0.22
83 0.2