Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PNP3

Protein Details
Accession F8PNP3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAKSKNHTNHNQNKKAHRNGIKKPKSYHydrophilic
NLS Segment(s)
PositionSequence
14-35KKAHRNGIKKPKSYRTRSMKGY
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKKPKSYRTRSMKGYRKNSLFALVGSRKARAEQNASTTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.81
4 0.81
5 0.79
6 0.8
7 0.84
8 0.82
9 0.8
10 0.79
11 0.79
12 0.79
13 0.76
14 0.76
15 0.74
16 0.72
17 0.73
18 0.76
19 0.74
20 0.75
21 0.76
22 0.74
23 0.67
24 0.63
25 0.56
26 0.5
27 0.42
28 0.33
29 0.33
30 0.27
31 0.3
32 0.29
33 0.3
34 0.26
35 0.28
36 0.33
37 0.31
38 0.35
39 0.34