Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QEI3

Protein Details
Accession F8QEI3   
Localization Confidence High
Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
33-58FDEKDIKMARRRKRQQERQQEEKMKABasic
NLS Segment(s)
PositionSequence
43-45RRK
97-101SKKSR
Subcellular Location(s) nucl 20, cyto 4, mito 1, pero 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR039905  CD2BP2/Lin1  
Gene Ontology GO:0005682  C:U5 snRNP  
Amino Acid Sequences MREEMEEGKFAADGTYVRSFDPHDVHDRWMDGFDEKDIKMARRRKRQQERQQEEKMKAEEQDIDENGGKGELERQLLGMLKKGETVLEALQRLGAKSKKSRPVNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.16
4 0.16
5 0.17
6 0.19
7 0.22
8 0.24
9 0.22
10 0.25
11 0.26
12 0.28
13 0.29
14 0.28
15 0.24
16 0.23
17 0.2
18 0.15
19 0.14
20 0.13
21 0.14
22 0.13
23 0.16
24 0.16
25 0.19
26 0.26
27 0.33
28 0.41
29 0.49
30 0.59
31 0.66
32 0.76
33 0.84
34 0.87
35 0.9
36 0.89
37 0.87
38 0.87
39 0.82
40 0.73
41 0.66
42 0.57
43 0.47
44 0.39
45 0.31
46 0.24
47 0.2
48 0.21
49 0.17
50 0.18
51 0.17
52 0.16
53 0.15
54 0.12
55 0.1
56 0.07
57 0.09
58 0.09
59 0.1
60 0.1
61 0.1
62 0.11
63 0.14
64 0.15
65 0.16
66 0.15
67 0.14
68 0.15
69 0.15
70 0.14
71 0.12
72 0.14
73 0.13
74 0.16
75 0.16
76 0.15
77 0.18
78 0.19
79 0.19
80 0.23
81 0.25
82 0.28
83 0.36
84 0.46
85 0.53