Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q9I6

Protein Details
Accession F8Q9I6   
Localization Confidence Medium
Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
32-52IWREREKEKKGSKTGKKPYSEBasic
93-119EKGHRSFKCKDAQKKKPQFNVREEKLLHydrophilic
NLS Segment(s)
PositionSequence
35-61EREKEKKGSKTGKKPYSEQKKEAEKKR
Subcellular Location(s) nucl 14.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00098  zf-CCHC  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MNKPLVDRVIYGGHIPRDYQEWKKELIRIDYIWREREKEKKGSKTGKKPYSEQKKEAEKKRDGTGYTYTGNGERMEVDKAKFHTEGRCYRCGEKGHRSFKCKDAQKKKPQFNVREEKLLEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.23
5 0.28
6 0.32
7 0.35
8 0.34
9 0.37
10 0.4
11 0.43
12 0.43
13 0.42
14 0.39
15 0.34
16 0.38
17 0.42
18 0.42
19 0.43
20 0.4
21 0.39
22 0.4
23 0.47
24 0.47
25 0.49
26 0.54
27 0.57
28 0.65
29 0.71
30 0.76
31 0.78
32 0.82
33 0.8
34 0.75
35 0.72
36 0.73
37 0.74
38 0.71
39 0.65
40 0.62
41 0.65
42 0.7
43 0.73
44 0.71
45 0.65
46 0.61
47 0.61
48 0.56
49 0.46
50 0.41
51 0.36
52 0.3
53 0.26
54 0.23
55 0.2
56 0.17
57 0.17
58 0.14
59 0.11
60 0.09
61 0.09
62 0.11
63 0.13
64 0.13
65 0.15
66 0.17
67 0.19
68 0.2
69 0.21
70 0.24
71 0.29
72 0.37
73 0.39
74 0.43
75 0.43
76 0.44
77 0.49
78 0.49
79 0.5
80 0.52
81 0.57
82 0.62
83 0.65
84 0.69
85 0.67
86 0.68
87 0.7
88 0.69
89 0.7
90 0.71
91 0.75
92 0.8
93 0.86
94 0.89
95 0.9
96 0.91
97 0.88
98 0.88
99 0.88
100 0.82
101 0.8
102 0.71