Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PST1

Protein Details
Accession F8PST1   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
6-33ELYASTRYAKKRKYRPKKSKLSQGQMEWHydrophilic
NLS Segment(s)
PositionSequence
14-25AKKRKYRPKKSK
Subcellular Location(s) nucl 19, mito_nucl 13.833, cyto_nucl 10.333, mito 7.5
Family & Domain DBs
Amino Acid Sequences MQRRLELYASTRYAKKRKYRPKKSKLSQGQMEWMDCPQNIGVESDYMVVWPETKHREWRSIIGVEVVIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.6
3 0.63
4 0.71
5 0.79
6 0.85
7 0.89
8 0.91
9 0.94
10 0.92
11 0.92
12 0.91
13 0.89
14 0.83
15 0.74
16 0.69
17 0.6
18 0.52
19 0.41
20 0.31
21 0.23
22 0.17
23 0.15
24 0.09
25 0.08
26 0.08
27 0.08
28 0.08
29 0.07
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.06
36 0.06
37 0.07
38 0.12
39 0.16
40 0.2
41 0.3
42 0.33
43 0.4
44 0.42
45 0.47
46 0.48
47 0.45
48 0.43
49 0.35