Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q0TZ03

Protein Details
Accession Q0TZ03    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-72HPKISHIRQKLRQDDCPRKEBasic
NLS Segment(s)
PositionSequence
33-45RASGRKRKFAPRR
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 9, cysk 3
Family & Domain DBs
KEGG pno:SNOG_15137  -  
Amino Acid Sequences MAEVSIMVCAKFGGRTEIGIRGGAGLLEHQRLRASGRKRKFAPRRSSEDYDHHPKISHIRQKLRQDDCPRKEQIDGFREG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.21
5 0.21
6 0.2
7 0.19
8 0.14
9 0.14
10 0.11
11 0.09
12 0.07
13 0.07
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.14
20 0.2
21 0.27
22 0.33
23 0.39
24 0.46
25 0.5
26 0.6
27 0.67
28 0.7
29 0.72
30 0.7
31 0.73
32 0.72
33 0.73
34 0.67
35 0.63
36 0.6
37 0.59
38 0.53
39 0.46
40 0.38
41 0.35
42 0.39
43 0.43
44 0.43
45 0.43
46 0.51
47 0.59
48 0.68
49 0.76
50 0.74
51 0.75
52 0.77
53 0.8
54 0.77
55 0.75
56 0.7
57 0.63
58 0.61
59 0.57
60 0.56