Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0TVH7

Protein Details
Accession Q0TVH7    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
141-163QAASARFRQKKKQREQQLMETTRHydrophilic
NLS Segment(s)
PositionSequence
137-152RKRNQAASARFRQKKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000977  F:RNA polymerase II transcription regulatory region sequence-specific DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG pno:SNOG_16487  -  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS50217  BZIP  
PS00036  BZIP_BASIC  
CDD cd14705  bZIP_Zip1  
Amino Acid Sequences MASLSGRDTYEPLDAAQLYHEHEDDYRALPPPLSSPQDGYAHGEYAYASHHSSGASLSGLQYTLPTMAAHPVPHHYEHEPSLLDDLNGFSPIAPNYNMNAYRTPYPDSNATSTSSATSPDAQFSTDTIIVEADEDKRKRNQAASARFRQKKKQREQQLMETTREMQDRTKKLEKENEGLKKENMFLKKLLVEKVDHMTEDDREMLRKAAGVVLERKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.16
4 0.15
5 0.15
6 0.17
7 0.16
8 0.14
9 0.14
10 0.17
11 0.17
12 0.17
13 0.17
14 0.17
15 0.18
16 0.17
17 0.18
18 0.19
19 0.24
20 0.26
21 0.25
22 0.25
23 0.29
24 0.31
25 0.31
26 0.32
27 0.27
28 0.24
29 0.22
30 0.2
31 0.15
32 0.13
33 0.14
34 0.1
35 0.09
36 0.09
37 0.09
38 0.09
39 0.1
40 0.09
41 0.09
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.06
52 0.06
53 0.06
54 0.08
55 0.1
56 0.1
57 0.11
58 0.13
59 0.15
60 0.17
61 0.19
62 0.18
63 0.2
64 0.21
65 0.22
66 0.19
67 0.17
68 0.17
69 0.14
70 0.12
71 0.1
72 0.09
73 0.08
74 0.08
75 0.07
76 0.05
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.09
83 0.13
84 0.14
85 0.15
86 0.16
87 0.16
88 0.18
89 0.19
90 0.22
91 0.18
92 0.19
93 0.2
94 0.2
95 0.21
96 0.19
97 0.19
98 0.17
99 0.16
100 0.15
101 0.13
102 0.12
103 0.1
104 0.11
105 0.1
106 0.11
107 0.11
108 0.1
109 0.1
110 0.1
111 0.12
112 0.1
113 0.1
114 0.09
115 0.09
116 0.08
117 0.08
118 0.09
119 0.09
120 0.14
121 0.15
122 0.18
123 0.22
124 0.26
125 0.28
126 0.3
127 0.36
128 0.39
129 0.49
130 0.54
131 0.61
132 0.68
133 0.72
134 0.73
135 0.75
136 0.75
137 0.75
138 0.77
139 0.78
140 0.78
141 0.82
142 0.84
143 0.84
144 0.85
145 0.78
146 0.7
147 0.61
148 0.53
149 0.45
150 0.4
151 0.31
152 0.27
153 0.32
154 0.34
155 0.4
156 0.47
157 0.47
158 0.53
159 0.61
160 0.6
161 0.59
162 0.64
163 0.65
164 0.61
165 0.61
166 0.56
167 0.49
168 0.47
169 0.46
170 0.41
171 0.34
172 0.31
173 0.32
174 0.34
175 0.35
176 0.35
177 0.31
178 0.29
179 0.3
180 0.35
181 0.32
182 0.27
183 0.26
184 0.25
185 0.23
186 0.24
187 0.24
188 0.19
189 0.2
190 0.21
191 0.2
192 0.18
193 0.18
194 0.17
195 0.16
196 0.17
197 0.2