Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PHN4

Protein Details
Accession F8PHN4    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
139-167VSSFKARTKDKMRVDKDKRRTKGKYGAGHBasic
NLS Segment(s)
PositionSequence
143-171KARTKDKMRVDKDKRRTKGKYGAGHHTRK
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cysk 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MGIWLVSGVLCMKVEELSQEQHGLHFKANTATTEQLEDTFLSVLGTKMKDIASHLWIVVQRLLKSPNDRRVKLRQNNDDMLAGFAPLVENDLGELGGTEELARDSEHDEESPMKKKPEASRGKKCCAADDSRKRSFALVSSFKARTKDKMRVDKDKRRTKGKYGAGHHTRKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.13
4 0.15
5 0.16
6 0.18
7 0.17
8 0.2
9 0.23
10 0.21
11 0.21
12 0.2
13 0.19
14 0.22
15 0.23
16 0.22
17 0.21
18 0.22
19 0.21
20 0.22
21 0.21
22 0.17
23 0.17
24 0.15
25 0.13
26 0.1
27 0.09
28 0.07
29 0.07
30 0.07
31 0.09
32 0.1
33 0.09
34 0.1
35 0.1
36 0.11
37 0.13
38 0.16
39 0.15
40 0.15
41 0.15
42 0.16
43 0.16
44 0.17
45 0.18
46 0.17
47 0.15
48 0.17
49 0.2
50 0.2
51 0.28
52 0.34
53 0.4
54 0.45
55 0.47
56 0.5
57 0.58
58 0.65
59 0.66
60 0.68
61 0.66
62 0.64
63 0.64
64 0.59
65 0.5
66 0.4
67 0.32
68 0.23
69 0.15
70 0.09
71 0.07
72 0.05
73 0.04
74 0.05
75 0.03
76 0.03
77 0.03
78 0.04
79 0.03
80 0.03
81 0.03
82 0.03
83 0.03
84 0.03
85 0.03
86 0.03
87 0.03
88 0.04
89 0.04
90 0.04
91 0.06
92 0.08
93 0.08
94 0.08
95 0.1
96 0.13
97 0.16
98 0.21
99 0.22
100 0.22
101 0.23
102 0.3
103 0.36
104 0.43
105 0.5
106 0.55
107 0.64
108 0.7
109 0.74
110 0.73
111 0.66
112 0.61
113 0.55
114 0.54
115 0.54
116 0.57
117 0.6
118 0.59
119 0.6
120 0.56
121 0.52
122 0.45
123 0.39
124 0.37
125 0.34
126 0.32
127 0.37
128 0.39
129 0.4
130 0.44
131 0.42
132 0.42
133 0.44
134 0.51
135 0.55
136 0.63
137 0.68
138 0.74
139 0.82
140 0.84
141 0.87
142 0.88
143 0.85
144 0.85
145 0.84
146 0.82
147 0.82
148 0.81
149 0.79
150 0.76
151 0.79
152 0.78