Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PTT1

Protein Details
Accession F8PTT1    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MREKWKKKRSRRLRRKRRKMRARSSSKRPIGCRBasic
NLS Segment(s)
PositionSequence
3-28EKWKKKRSRRLRRKRRKMRARSSSKR
Subcellular Location(s) mito_nucl 12.833, nucl 12.5, mito 11, cyto_nucl 8.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR007836  Ribosomal_L41  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF05162  Ribosomal_L41  
Amino Acid Sequences MREKWKKKRSRRLRRKRRKMRARSSSKRPIGCRACESQDVLKYRNDAMFMRRTTLSSPHYRWPAAKPRAVLPCRGGACTSTVPLLKLPLGLKVTCT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.97
2 0.98
3 0.98
4 0.98
5 0.97
6 0.97
7 0.96
8 0.96
9 0.95
10 0.93
11 0.92
12 0.91
13 0.88
14 0.83
15 0.75
16 0.74
17 0.7
18 0.65
19 0.59
20 0.53
21 0.49
22 0.44
23 0.43
24 0.37
25 0.35
26 0.34
27 0.31
28 0.28
29 0.25
30 0.25
31 0.23
32 0.21
33 0.16
34 0.17
35 0.21
36 0.2
37 0.21
38 0.2
39 0.2
40 0.2
41 0.24
42 0.25
43 0.26
44 0.28
45 0.32
46 0.35
47 0.35
48 0.36
49 0.39
50 0.45
51 0.44
52 0.44
53 0.4
54 0.43
55 0.52
56 0.51
57 0.48
58 0.4
59 0.41
60 0.39
61 0.38
62 0.33
63 0.23
64 0.26
65 0.24
66 0.22
67 0.18
68 0.18
69 0.18
70 0.18
71 0.19
72 0.16
73 0.18
74 0.17
75 0.2
76 0.23