Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PNW6

Protein Details
Accession F8PNW6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
2-27QSTRGISYVKRKKNTQTCKKIIPNISHydrophilic
47-68QVKIGKKKNCPDTTKKEPRRAGBasic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MQSTRGISYVKRKKNTQTCKKIIPNISECLGINLRFFSNGRITAAEQVKIGKKKNCPDTTKKEPRRAGAGVFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.81
3 0.81
4 0.81
5 0.79
6 0.82
7 0.83
8 0.81
9 0.76
10 0.72
11 0.64
12 0.57
13 0.51
14 0.43
15 0.35
16 0.3
17 0.26
18 0.19
19 0.15
20 0.13
21 0.12
22 0.12
23 0.12
24 0.11
25 0.12
26 0.12
27 0.13
28 0.13
29 0.14
30 0.19
31 0.21
32 0.19
33 0.17
34 0.19
35 0.24
36 0.28
37 0.33
38 0.32
39 0.38
40 0.46
41 0.56
42 0.62
43 0.64
44 0.69
45 0.72
46 0.78
47 0.82
48 0.83
49 0.82
50 0.8
51 0.77
52 0.75
53 0.68
54 0.6