Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PQY3

Protein Details
Accession F8PQY3    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
50-69GVAPRAKMNQQRSRRFRSAQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, cyto_nucl 15, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR027073  5_3_exoribonuclease  
IPR004859  Xrn1_N  
Gene Ontology GO:0004534  F:5'-3' RNA exonuclease activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03159  XRN_N  
Amino Acid Sequences MNGIVHPCTHPDNKPAPETEEEMMVDIFSYTERVVNMVRPRKVLFMAIDGVAPRAKMNQQRSRRFRSAQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.43
3 0.42
4 0.4
5 0.4
6 0.34
7 0.27
8 0.23
9 0.2
10 0.18
11 0.13
12 0.1
13 0.07
14 0.06
15 0.04
16 0.05
17 0.04
18 0.05
19 0.05
20 0.06
21 0.07
22 0.11
23 0.19
24 0.25
25 0.26
26 0.27
27 0.28
28 0.29
29 0.29
30 0.27
31 0.21
32 0.17
33 0.17
34 0.15
35 0.15
36 0.13
37 0.14
38 0.12
39 0.11
40 0.09
41 0.1
42 0.16
43 0.23
44 0.33
45 0.42
46 0.52
47 0.63
48 0.71
49 0.78
50 0.8