Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QL11

Protein Details
Accession F8QL11   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
65-84PIALRRPVRARRPPRPWWLLHydrophilic
NLS Segment(s)
PositionSequence
70-78RPVRARRPP
Subcellular Location(s) nucl 15, cyto 6, mito 3, pero 3
Family & Domain DBs
Amino Acid Sequences MPLGLIEDVPAPGPGGDMGSPAALQQPQPLPDNGPHLDLDAKPPVNQLPELPNHPPHRSPSPDLPIALRRPVRARRPPRPWWLLHRQPTPAIESDDSDSEAVDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.07
5 0.08
6 0.07
7 0.07
8 0.07
9 0.09
10 0.09
11 0.09
12 0.12
13 0.15
14 0.17
15 0.2
16 0.2
17 0.2
18 0.21
19 0.27
20 0.24
21 0.22
22 0.2
23 0.18
24 0.2
25 0.17
26 0.19
27 0.18
28 0.18
29 0.16
30 0.17
31 0.17
32 0.17
33 0.17
34 0.15
35 0.14
36 0.15
37 0.18
38 0.2
39 0.25
40 0.27
41 0.29
42 0.29
43 0.29
44 0.33
45 0.35
46 0.36
47 0.37
48 0.38
49 0.38
50 0.37
51 0.35
52 0.35
53 0.33
54 0.35
55 0.29
56 0.27
57 0.33
58 0.4
59 0.48
60 0.53
61 0.61
62 0.65
63 0.73
64 0.79
65 0.81
66 0.8
67 0.75
68 0.74
69 0.74
70 0.74
71 0.74
72 0.71
73 0.65
74 0.61
75 0.58
76 0.53
77 0.45
78 0.4
79 0.32
80 0.29
81 0.29
82 0.26
83 0.26
84 0.22
85 0.19