Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8QBG1

Protein Details
Accession F8QBG1    Localization Confidence High Confidence Score 16.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-62SDTIKVKKAKVSKKKAYSTSSHydrophilic
205-228NKTGSNKKVKSKMRLKGTTRYARPHydrophilic
NLS Segment(s)
PositionSequence
48-56KKAKVSKKK
210-233NKKVKSKMRLKGTTRYARPMTKRP
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 3
Family & Domain DBs
Amino Acid Sequences MLIVTTTNKHNNDDEDNKNEDNIVIAEVLPTSKKYKAMNDKSDTIKVKKAKVSKKKAYSTSSLSPFPSPSPPCSPTPLPLPLHKPTPLSPACVQTPAPLLLCKPAPAPPPPPAHTPTPTPPASPHSCNTADKDNYALLVATPKWPMPNPLQVSKNYMSLLSANIKIIPLPLVPIPPPKEKTNDADKENTASGTKGKAATLNVSANKTGSNKKVKSKMRLKGTTRYARPMTKRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.5
4 0.47
5 0.44
6 0.39
7 0.31
8 0.24
9 0.19
10 0.14
11 0.09
12 0.09
13 0.09
14 0.08
15 0.09
16 0.09
17 0.1
18 0.13
19 0.15
20 0.2
21 0.23
22 0.33
23 0.43
24 0.52
25 0.6
26 0.62
27 0.66
28 0.66
29 0.7
30 0.65
31 0.58
32 0.55
33 0.51
34 0.52
35 0.53
36 0.57
37 0.6
38 0.65
39 0.72
40 0.75
41 0.79
42 0.81
43 0.82
44 0.78
45 0.73
46 0.69
47 0.65
48 0.6
49 0.52
50 0.46
51 0.4
52 0.36
53 0.32
54 0.33
55 0.28
56 0.28
57 0.33
58 0.34
59 0.35
60 0.39
61 0.39
62 0.34
63 0.37
64 0.38
65 0.34
66 0.35
67 0.39
68 0.36
69 0.38
70 0.37
71 0.34
72 0.29
73 0.35
74 0.32
75 0.31
76 0.3
77 0.3
78 0.29
79 0.28
80 0.27
81 0.2
82 0.21
83 0.17
84 0.16
85 0.13
86 0.12
87 0.12
88 0.13
89 0.12
90 0.1
91 0.13
92 0.15
93 0.18
94 0.21
95 0.25
96 0.31
97 0.32
98 0.35
99 0.34
100 0.35
101 0.34
102 0.34
103 0.31
104 0.32
105 0.3
106 0.27
107 0.25
108 0.28
109 0.3
110 0.29
111 0.26
112 0.26
113 0.28
114 0.28
115 0.3
116 0.31
117 0.27
118 0.25
119 0.25
120 0.2
121 0.18
122 0.16
123 0.14
124 0.06
125 0.08
126 0.08
127 0.08
128 0.09
129 0.1
130 0.11
131 0.12
132 0.15
133 0.17
134 0.25
135 0.27
136 0.32
137 0.35
138 0.35
139 0.41
140 0.38
141 0.37
142 0.28
143 0.24
144 0.19
145 0.17
146 0.18
147 0.15
148 0.15
149 0.13
150 0.13
151 0.13
152 0.12
153 0.12
154 0.1
155 0.07
156 0.08
157 0.09
158 0.1
159 0.12
160 0.18
161 0.23
162 0.28
163 0.32
164 0.33
165 0.38
166 0.4
167 0.44
168 0.48
169 0.5
170 0.48
171 0.49
172 0.47
173 0.45
174 0.42
175 0.38
176 0.28
177 0.22
178 0.2
179 0.17
180 0.19
181 0.16
182 0.16
183 0.18
184 0.19
185 0.21
186 0.24
187 0.28
188 0.29
189 0.3
190 0.3
191 0.27
192 0.29
193 0.3
194 0.32
195 0.34
196 0.41
197 0.45
198 0.53
199 0.63
200 0.69
201 0.75
202 0.78
203 0.79
204 0.8
205 0.84
206 0.8
207 0.8
208 0.82
209 0.82
210 0.77
211 0.77
212 0.73
213 0.72