Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8Q631

Protein Details
Accession F8Q631    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGMRLSLRRVRRRQSLPHVLNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021109  Peptidase_aspartic_dom_sf  
Amino Acid Sequences MGMRLSLRRVRRRQSLPHVLNTDAPISNIQEFVYLIPIQIGGQNFWVTFDTGSSDLVSRFLLPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.76
4 0.75
5 0.7
6 0.61
7 0.55
8 0.46
9 0.38
10 0.27
11 0.23
12 0.16
13 0.14
14 0.13
15 0.12
16 0.1
17 0.08
18 0.08
19 0.07
20 0.09
21 0.07
22 0.07
23 0.06
24 0.06
25 0.06
26 0.08
27 0.09
28 0.07
29 0.08
30 0.09
31 0.09
32 0.1
33 0.11
34 0.09
35 0.09
36 0.09
37 0.11
38 0.11
39 0.12
40 0.11
41 0.11
42 0.11
43 0.12
44 0.13