Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q262

Protein Details
Accession F8Q262    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
38-62DEIRGMRRKSPRRHIFEYKKRTFPYBasic
NLS Segment(s)
PositionSequence
45-48RKSP
Subcellular Location(s) nucl 16, cyto 4, cysk 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MRYSIDIRILPLVEVISEIKYYTSTPSRYTDTTAFDTDEIRGMRRKSPRRHIFEYKKRTFPYSAAVNIFCNLEIVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.08
5 0.08
6 0.08
7 0.08
8 0.09
9 0.12
10 0.16
11 0.17
12 0.2
13 0.23
14 0.26
15 0.27
16 0.3
17 0.28
18 0.27
19 0.28
20 0.26
21 0.23
22 0.2
23 0.19
24 0.16
25 0.17
26 0.13
27 0.11
28 0.14
29 0.15
30 0.21
31 0.3
32 0.39
33 0.45
34 0.56
35 0.65
36 0.69
37 0.76
38 0.81
39 0.83
40 0.84
41 0.86
42 0.82
43 0.8
44 0.74
45 0.7
46 0.62
47 0.53
48 0.49
49 0.45
50 0.42
51 0.38
52 0.37
53 0.34
54 0.32
55 0.31
56 0.24